KEGG   Pantoea sp. At-9b: Pat9b_4212Help
Entry
Pat9b_4212        CDS       T01386                                 

Definition
(GenBank) type III effector Hrp-dependent outer domain protein
  KO
K21948  3-dehydrotetronate 4-kinase [EC:2.7.1.217]
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pat9b_4212
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.217  3-dehydrotetronate 4-kinase
     Pat9b_4212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBD_N NBD_C
Motif
Other DBs
NCBI-ProteinID: ADU72776
UniProt: E6WMZ1
Position
pPAT9B04:85060..86331
Genome map
AA seq 423 aa AA seqDB search
MLIGVIADDFTGASDIAVTLAKGLPHEGGLRTTLYLGIPEKPAAVEVEAGVIALKSRSIP
AKEAVMQSLAACRWLIAQGCRQIVFKYCSTFDSTAEGNIGPVAEALAAFLGQKAVPVCPS
FPSMGRTVYQGHLFVRDRLLNESGMEHHPLTPMKDADIRRVLQSQSTSQPGHIAWPVVQR
GMAAIRTALDHAVTQGETLTVIDALQDEDLIAIGKACADTRLLTGGSGIAIGLPHNFIQR
GLAAGVGSVVPEIDGPEAILVGSCSGTTLRQIAAHAKAHPVMMVSVDEVMKGAIRAEQLV
SFIQANEGKSPLVFTSGDKADVLRAQDVYGRETVSATLDALFGKTAQALVAAGIRRLVVG
GGETSGAVVSALNLGELKIGEEIDTGVPALVSPGEHPIALALKSGNFGSEDFFSKAVATL
RGQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcggggtgattgcagatgatttcaccggggcgagtgatattgccgtcacgctg
gcgaaagggctgccacacgaggggggattacgcacgacgttgtacctgggcatcccggaa
aaacccgctgccgttgaggttgaagcgggcgttatcgcgctgaaaagccgttcaattccg
gcgaaagaggcggtaatgcaatcgctcgccgcctgcagatggctgattgcccaaggctgt
cgtcaaattgtattcaagtactgttccacctttgattccaccgcagagggtaatatcggc
ccggttgcggaagcgctggccgctttcctcggtcagaaagcggtgccggtgtgtccttct
tttccttccatgggccgcaccgtctatcaggggcatttatttgtccgggaccggttattg
aatgaatcaggaatggaacaccacccgttaacgccgatgaaagacgccgacatccgacgc
gtgttgcagtctcaatcgaccagccaacccggccatattgcatggccggtggtgcagagg
gggatggcagcgattcgtaccgcgctggatcatgccgttacgcagggcgagacactgacg
gtgatagacgcgttgcaagacgaggatctcatcgccatcgggaaggcctgtgccgatacg
cgcttgctgaccggcggttctggtattgccatcggtttgccccataacttcattcaacgt
ggtctggcggcgggggttggcagtgttgtgcctgagattgacggccctgaagcgattctg
gtcgggagctgttccggtaccacattgcggcagatcgccgcacatgccaaagcacatccg
gtgatgatggtcagtgttgatgaggtgatgaaaggggctattcgcgccgagcagttggtg
tcatttatccaggcgaatgaagggaaatcgccgctggtgttcacctccggcgataaagcg
gatgtactccgcgcgcaggacgtctatggacgcgaaactgtctctgccacacttgacgcg
ttgtttggcaaaacggcgcaggcgctggtcgcggcgggcattcggcggctggtggtgggc
ggcggtgaaacttcaggtgcggtggtcagtgcgttgaatcttggtgagctgaagattggt
gaagagattgatactggcgtgccagcccttgtctctccgggagaacatcccattgcttta
gccctgaagtcaggcaattttggcagcgaagacttcttctctaaagctgtcgctacccta
cgcggccaataa

DBGET integrated database retrieval system