KEGG   Pantoea sp. At-9b: Pat9b_4218Help
Entry
Pat9b_4218        CDS       T01386                                 

Definition
(GenBank) TonB-dependent siderophore receptor
  KO
K19611  ferric enterobactin receptor
Organism
pao  Pantoea sp. At-9b
Pathway
pao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pat9b_4218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4218
Transporters [BR:pao02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pat9b_4218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-ProteinID: ADU72782
UniProt: E6WMZ7
Position
pPAT9B04:91803..94094
Genome map
AA seq 763 aa AA seqDB search
MSHLIGKRKTTLSLLIGLVIHSGYSLAAETPTNVLSLQEQEAVTKTTSDTAKKTTTAPTV
NPTNEDTMVVSAKAEEKLKQQPGASLITKEDLERNPPVNDLSEIIRKMPGVNLTGNSATG
SRGNNRQIDIRGMGPENTLILIDGVPVSSRSSVRYSRTGERDTRGDSNWVPPEMVDHIDV
LRGPAAAHYGSGAMGGVVNIVTKRPTNDWHGSLSLYTNQPEDKDEGATKRMNFSLSGPLI
DDVLTMRLYGNINKTDADAYDINTNENGSYAAGREGVRNRDINTAVQWKINPQQYMDFNY
AYSRQGNIYAGDTQYSNSNLSTLVPTLYGQETNRMYRQSYSVTHNGIWDWGQSKLTLSYE
DTHNTRLDEGSTGKVEGMINSDTYNTSRYKTWRVNNEYTIPFTLLVDNTLTLGGEWNKEQ
LNDPASMQETDATGIDINGVSGDPSQRSSKNSQELSAIYLEDTIDAFDSTTLIPGLRFDY
SDRFGSNWSPSLNIQQELGDHLTLKAGIARVFKAPNLYQSSEGYLLASSGNGCNVGGSNG
CYLMGNSDLKPEISVNKEVGLQWTDEGYSAGLTYFRNDYQNKIVAGDTSLGTVNVASSWY
SSTYDIYQWQNGGKALTQGLEANLTIPLVEDTLNWRTNATYMFTSKYKSTGNPLSLIPKY
TVNSWLDWQMTDALSATLSWTMYGRQHPRTTAEIRKEASGLSENEVGAYAIFGTGLNYQY
NKNLRFNVGISNLLNKQIYRENEGASTYNEPGRAYYAGVTTSF
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacttaattggaaaaaggaaaacgaccctgtcattactgattgggctggtcatc
cacagtggctactctctggcagccgaaacaccaacgaatgttttatcgttacaggagcag
gaggcggtaaccaaaacgacctctgacaccgcaaagaaaaccaccactgcaccgacggtc
aatccgaccaacgaagacaccatggtggtgtcggccaaagccgaagagaaacttaagcaa
cagcctggcgcatcgctgatcaccaaagaagacctcgaacgcaacccaccggttaacgac
ctgtccgaaatcattcgcaagatgccgggtgtgaatttaaccggcaacagtgcgaccgga
agtcgtggcaacaaccgccagattgatattcgcggtatggggccggaaaacaccctgatc
ctgattgatggcgtgccggtatcttcgcgcagctctgtacgttacagccgtaccggcgag
cgagacacccgtggcgacagcaactgggtgccaccggagatggtggatcatatcgatgtg
ttacgtggcccggctgctgcgcactatggctccggggcgatgggcggggtggtgaatatc
gtcaccaaacgcccgacgaacgactggcatggctcgttatcgctctacaccaaccaaccg
gaagacaaggatgaaggtgcgaccaaacgcatgaacttcagcctgagcggcccgctgatc
gatgatgtgctgaccatgcgcctgtatggcaacatcaacaagacggacgctgacgcctac
gatatcaacaccaacgaaaacggttcttatgcggcgggtcgcgaaggggtgcgcaaccgc
gatatcaacaccgcagtacagtggaagatcaatccgcagcagtacatggattttaactac
gcttacagtcggcagggcaatatctatgctggtgatacccagtacagcaacagcaacctg
agtaccctggtaccgaccttatacggtcaggaaaccaaccgtatgtaccgccagtcctac
agcgtgacccataacggcatctgggactggggccagtcaaaactgactctgagttatgaa
gacacccacaacacccgtctggatgaaggttcaaccggtaaagtggaagggatgatcaac
agcgacacctataacaccagccgttataaaacctggcgcgtcaataatgagtacaccatt
cccttcaccctgctggtggataacaccctgacgctcggcggtgaatggaataaggaacag
ctgaacgatccggcatcgatgcaggaaacggacgcgaccggcattgatatcaacggtgta
tccggcgatccgtcgcagcgcagcagcaaaaacagccaggagctgagcgccatttacctg
gaagacaccattgatgccttcgactccaccacgctgatcccggggctgcgttttgactac
agcgatcgctttggcagcaactggagcccgagcctgaacattcagcaggagttgggtgat
caccttacactgaaagccggtattgcccgtgtgttcaaagcacccaacctgtatcagtcc
agtgaaggttatctgctggcaagcagtggcaacggttgtaacgttggaggcagcaacggc
tgttatctgatgggtaatagcgatctgaaacctgaaatcagcgttaacaaagaggttggg
ctgcaatggactgatgaaggttacagcgcgggcctgacttatttccgcaacgattatcag
aataagatcgtggccggcgacacgtctctgggaacggtgaatgtagccagctcctggtat
tcatcaacctatgatatttatcagtggcagaatggtggcaaggcgctgactcagggtctt
gaggccaacctgaccatcccgctggtggaagacaccctgaactggcgtaccaatgcgact
tatatgtttacctcgaaatataagtcgaccgggaatccactctctctgatcccgaaatac
acggtgaacagttggctggactggcagatgaccgatgcactgtccgccaccctgagctgg
acgatgtatggtcgccagcatccgcgtaccacagctgaaatccgtaaggaagccagcggg
ttgtcggaaaatgaggtgggtgcctacgccatctttggtaccggactgaactatcagtac
aacaaaaacctgcgtttcaacgtcggtatcagcaacctgctgaacaagcaaatctatcgt
gaaaacgaaggggcttcgacctacaacgagccaggccgcgcgtattatgcgggtgtgacc
acctcgttctga

DBGET integrated database retrieval system