KEGG   Pantoea sp. At-9b: Pat9b_4223Help
Entry
Pat9b_4223        CDS       T01386                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Epimerase NAD_binding_4 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADU72787
UniProt: E6WN02
Position
pPAT9B04:complement(97103..97750)
Genome map
AA seq 215 aa AA seqDB search
MSTRTVLLAGATGLVGGLMLEALLADQTVSAVHALSRRPLAIHHPKLQVHTVDFSRLPAL
PATDEVYLALGTTIKVAGSQAAFRAVDFSANLAVAHAAGARRVGLVSAAAANATSGVFYN
RVKGELEDALKAMDLDALVIAQPSLLLGSREHLQQQRRMGEIIASPIARLLAPVLPGAYR
PVSARAVAQALVSTVPTANGLVVLPSDVLAKFDRN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaagaaccgtattgctggccggagccaccggtctggtgggggggctgatgctt
gaggccctactggctgatcagactgtctcggccgtgcatgcgctgagccgtcgaccgtta
gcgatccaccatcctaaacttcaggtccacacggtggattttagccgtctgcccgcgttg
cccgcgacggatgaggtctatctggcactcggcaccaccatcaaggtagcaggcagccag
gccgcgtttcgtgcggtcgatttctcggccaatctggcggttgctcacgcagccggggcg
cggcgggtgggattggtcagcgctgccgccgccaatgccacatccggcgttttctataac
cgggtgaaaggagaactggaggatgcgctcaaagcgatggacctcgacgcgctggtgatt
gcccaaccttccctgctgctcggttcacgggaacacctgcaacaacaacggcgtatggga
gaaataattgccagcccaattgcccggctcctcgcccccgtcttgcccggcgcttaccgt
ccggtgtcggcacgcgccgtggcgcaagcgctggttagcaccgtcccaactgcaaacggt
ctggtggtccttccctcagatgtattggccaagtttgaccgcaactga

DBGET integrated database retrieval system