KEGG   Pantoea sp. At-9b: Pat9b_4224Help
Entry
Pat9b_4224        CDS       T01386                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08166  MFS transporter, DHA2 family, methylenomycin A resistance protein
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4224
Transporters [BR:pao02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    Pat9b_4224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ADU72788
UniProt: E6WN03
Position
pPAT9B04:complement(97810..99165)
Genome map
AA seq 451 aa AA seqDB search
MQIHKTGRDRLFTAAVCLGFVLVQLDVSIVNVGLEVLRQHFQAGIADLEWVMNTYSLLFA
SLLLGAGTLGDRFGVRNVFVCGILIFIGASLSCAFAPTIYWLDTARGIQGVGAALLVPSS
LTLLRQYFSDHHARAGAIAMWAACGSFALAAGPVVGGVLIKWLGWKSIFLINVPVGLLSV
FFTLRFAPISPRFQRKINIASQVLIVLALGLLTFALTESAHFGWGSRTTLSTLLVGLAAL
VWFILSEKKSADPVVMPSVLQNRLIVSSVIIGFLCNMVFYGAVFIFSIFFQSELKLSALQ
TGLAFLPMMLFTAVVNYSSSKLGRRFRLRWLSCLGSLVSLTGFALLLLIKPDWSTWALFI
PMMLLGAGTSLAMPGVANLIFSQATHQEAGSASALFSCARQMGGVMGVAVFGLMISYTGD
ANLISGLKLIAATAMLMSVIWWVISRARLPA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatacataaaacgggccgggaccggctgttcaccgccgccgtatgtctgggtttt
gttctggttcagttggatgtcagtattgttaacgtgggcctggaagtcctgcggcagcat
tttcaggcgggaatcgccgatctcgaatgggtgatgaatacctactccctgctgtttgcc
tcgttgctgttgggtgccggcacccttggcgatcgctttggggtcagaaacgttttcgtc
tgtgggattttgattttcattggggcttcgctcagttgcgcttttgcaccgacgatatat
tggctcgacaccgcacgcggcattcagggcgtcggcgcggcgctgctggtccccagctca
ctgacgctattgcggcaatatttttccgaccaccacgcgcgcgccggggccattgccatg
tgggcagcatgtggtagtttcgcgctggcggcaggcccggtcgtcggtggcgtgctgatt
aagtggctgggatggaaaagcattttcctgatcaacgtgcctgtgggcctgctgagcgta
tttttcacgttacgctttgcgccgatcagcccgcgttttcagcggaaaataaacatcgcc
agccaggttttgattgttctcgccctcgggctgctcaccttcgccctgacagaatctgcg
cattttggctggggaagccggacgacgttatccacgttgttggtcgggctggcggcactg
gtgtggtttattctgagtgagaaaaaatcagccgatccggttgtgatgccatccgtgctg
caaaatcgattgatcgtcagcagtgtgatcatcggctttctttgcaatatggttttttac
ggtgccgtgttcattttcagcatttttttccagagtgagcttaagctcagcgcattacag
accggtctggccttcctgccaatgatgctgtttaccgccgtggtgaattacagcagcagc
aagctgggcagacgttttcgcctgcgctggctgtcatgtctgggcagtctggtgagcctt
accgggttcgcgctgttgctactgattaaaccggactggagtacctgggcgttgtttatt
ccgatgatgttgttgggtgccggaacctccctggcaatgcccggggtggcaaacctgatc
ttttcgcaggcgacacatcaggaagccggatcggcctcggcactgttctcctgcgcacgg
cagatgggcggtgtgatgggggtggcggtattcggtctgatgatcagttacaccggtgat
gcgaacctgattagcggtctgaaattgattgccgcgacggcgatgctaatgtccgttatt
tggtgggtgatcagcagagcgcgtttgccagcataa

DBGET integrated database retrieval system