KEGG   Pantoea sp. At-9b: Pat9b_4229Help
Entry
Pat9b_4229        CDS       T01386                                 

Definition
(GenBank) Cl-channel voltage-gated family protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC
Motif
Other DBs
NCBI-ProteinID: ADU72793
UniProt: E6WN08
Position
pPAT9B04:complement(103745..105001)
Genome map
AA seq 418 aa AA seqDB search
MTPPVGAKHALLRLIAVVMTGFLAGVAGMLLAMILHSIQHLAFGYSMDRIISPESFLQGV
TDSDRLRRMAAIVTGGLVAGGGWWLLGRYGRKRVSIKAAVSSHATPMPPGTTTLHALLQI
VTVALGSPLGREVAPREMGALAGGFMARRIGLETDEARILIACGAGAGLAAVYNVPLAGA
LFTLEVLLLSFSWEKALAAIITSAIAAWTATLGLGNESQYHFTSGPLAHNFLAWAIVAGP
LLGCGAWLFRKTTGAARAGVKENWQMPVFCLLAFTLLAVLSLWFPELPGNGKGPMQLALN
DSINFHHAALLLGLKMVVILAVLRGGAEGGLLTPGLTVGGLLSLLLCAIWQPFFPGGDTG
SFALVGGAAFLAASMQMPLTAVTLVMEFTHMNHDYFVPALLCAAGAVITCRVLEKTQR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactcctcctgttggcgcaaaacatgcgctgcttcgtctgattgcggtggtaatgacc
ggatttctcgcgggtgtggcggggatgttgctcgccatgattttgcacagcatccagcat
ctcgcgtttggttacagcatggaccgcattatcagtccggaatcctttttacagggggtg
acggactctgatcgactgcggcggatggccgcgattgtaaccggcggtctggtagcaggt
gggggttggtggttactgggacgttatgggcgcaagcgggtttccatcaaagccgccgtt
tcgtctcacgccacaccgatgccgcctggcaccaccaccctgcatgccctgctgcaaatc
gtgaccgttgcgctgggatcgccgctggggcgtgaagtcgccccacgggaaatgggtgcg
ctggcgggcggttttatggcacgccgtatcgggcttgagaccgatgaggcccggattctg
attgcctgtggtgccggagccggtctggctgccgtctataacgtgccgctggccggtgcg
ctgttcaccctggaagtgttgttgctgtcgttcagttgggaaaaagcgctggccgcgatc
attacctcggctatcgccgcctggaccgcgacgctcgggctgggtaatgaatcacaatat
cactttacctctggccctcttgcgcacaacttcctggcgtgggccattgtggctggccca
ttactgggttgcggtgcgtggttgtttcgcaaaaccaccggtgccgcacgcgccggggtg
aaagaaaactggcagatgccagtgttttgtttgctggcattcaccttacttgccgttctc
agcctctggttcccggagctgccgggtaacggtaaaggaccgatgcagttggcgctgaac
gacagcatcaattttcaccatgcggcgttgctgttaggtttgaaaatggtggtgattctg
gcggtgctgcgcggtggtgctgaaggtgggctactgacgccaggactgacggtcggcgga
ctgctaagcctgctactttgcgcgatctggcagccgtttttccctggtggagacactggc
agctttgcgctggtcggaggcgcagcatttctcgccgcctcgatgcaaatgccactgacc
gccgtgacgctggtaatggagtttacccatatgaaccatgactattttgttcctgccctg
ctgtgcgccgcaggcgcggtgatcacctgccgggtgctggagaaaacgcagcgttaa

DBGET integrated database retrieval system