KEGG   Pantoea sp. At-9b: Pat9b_4232Help
Entry
Pat9b_4232        CDS       T01386                                 

Definition
(GenBank) transporter, hydrophobe/amphiphile efflux-1 (HAE1) family
  KO
K18138  multidrug efflux pump
Organism
pao  Pantoea sp. At-9b
Pathway
pao01501  beta-Lactam resistance
pao01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pao_M00647  Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:pao00001]
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    Pat9b_4232
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Pat9b_4232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4232
   01504 Antimicrobial resistance genes [BR:pao01504]
    Pat9b_4232
Transporters [BR:pao02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Pat9b_4232
Antimicrobial resistance genes [BR:pao01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    Pat9b_4232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: ADU72796
UniProt: E6WN11
Position
pPAT9B04:complement(106029..109169)
Genome map
AA seq 1046 aa AA seqDB search
MSRFFIDRPIFAWVLAIIVMLAGGISILKLPVEQYPDVAPTSVQIRATYPGADATTLQNS
VTQVIEQNMSGLDGLMYMSSTSDSSGTLQLTLSFENGTDPDIAQVQVQNKLQLATPLLPQ
EVQQQGITVRKSSSVFFLVPGFVDDTGRMSMEDIADYVAANLKDPISRINGVGDTTLFGS
QYAMRIWLDPNKLNNYQLTPVDVMNMIETQNAQIAAGQLGGAPPVKGQQLNASIIAQTRL
TSPEEFGNILLKVNSDGSQVRLHDVARIERGGENYNFVVKINGKPASALGIQLAAGANAL
DTANAIRAKIDELKPYFPQGLKVVYPYDTTPFISISIHEVVKTLFEAIVLVFLVMYLFLQ
SFRATLIPTIAVPVVLLGTFGILAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
AEEGLKPKAATRKSMGQIQGALVGIALVLSAVFVPMAFFGGSTGVIYRQFSITIVSAMVL
SVLVALILTPALCVTILKPVKPGSHGQHRGLFGWFNRKFDQSAHHYTNSVARMLHRSGRY
LLIYGVLVAGMAVLFMRLPTSFLPSEDQGVLATQAILPAGATQERTQAVLDQVNDYYLKN
EKNNVENVLTVNGFGFAGRGQNVGIAFIGLKDWSQRPGEENKVDGIVSRAAKAFSNIMDG
NVVAFNLPPIIALGNATGFDFELIDQGSLGHDKLVAARNKLLELARQHPDTLVAVRPNGM
EDSPQYKLNVDQEKATALGVDLSDINTTLSSAWGGSYVNDFVDHGRVKKVYVMSDAPYRM
MPKDLDNWYVRASNGKMVPFASFSTAEWVYGSPRLERYNGLSSLEILGQPAAGKSSGEAM
ALMEQLAKQLPPGVGYDWTGMSYQERMTGEQAPALYALSLIVVFLCLAALYESWSIPFSV
MLVVPLGVFGALVATLLRGLNNDVYFVVGLLTTIGLSAKNAILIVEFAKDQIEKEGKGVV
EATLEAARMRLRPILMTSLAFILGVLPLALSSGAGSGAQNAVGTGVIGGMVAATLLAIYF
VPVFFVVVRNRFGGKSRDDEDDDILV
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgtccagattctttattgaccgcccgatctttgcctgggtgctggcgattatcgtcatg
ctggccgggggaatatcgatcctgaagctgccggtggaacagtaccctgacgttgcgcct
acctcagtgcaaatccgcgcgacctatccgggggcggatgccaccaccttgcagaacagc
gtgactcaggtgattgagcagaacatgagcgggctggatggcctgatgtatatgtcctcc
accagcgattcgtccggtacgctgcaactgacgctgtcgtttgaaaacggcactgacccg
gatatcgctcaggtgcaggtgcagaacaaattgcagctcgctaccccgctgctgccgcag
gaagtgcagcagcaaggcatcacggtgcgcaagtcctccagcgtgttcttcctcgtgccg
ggttttgttgatgacaccggccgcatgagtatggaagacatcgccgactacgtggcagct
aacctgaaagaccccatcagccgtatcaatggcgtgggtgacaccacgctgtttggttcg
caatacgcgatgcgcatctggctcgatcccaacaagctgaacaactaccaactgacgccg
gtcgatgtgatgaacatgatcgaaacccagaatgcgcagatcgccgcgggccagttgggt
ggcgcgccgccggtaaaaggtcagcagttgaatgcttcgatcattgcccagacccgtctt
acctcgccggaagagttcggtaacatcctgctgaaagtcaacagcgatggttcacaggtg
cgactgcatgatgtggcgcgtatcgaacgcggcggcgagaactataactttgtcgtcaag
atcaatggtaaacctgcgtcagcgttaggcattcagctggcggcaggcgctaacgcgctg
gacaccgccaatgccatccgcgcgaaaatcgatgagctgaaaccctactttccacagggc
ctgaaggtggtgtatccctacgacaccacgccgtttatcagcatctcgatccacgaggtg
gtgaaaacgttattcgaagccatcgtgctggtgttcctggtgatgtatctgtttttgcag
agcttccgcgccacattgatcccgaccatcgccgtgccggtggtgttgcttggcaccttc
ggcatcctcgccgccttcggctattcgatcaacacgctgacgatgttcgggatggtgctg
gcgattggcctgttggtggatgacgccatcgtggtggtggagaacgtggagcgtgtgatg
gctgaagaaggtctgaagccaaaagccgcgacacgtaaatcgatggggcagatccagggc
gcgctggtcggcattgcactggtgttgtcggcggtgtttgtaccgatggcgttctttggt
ggcagtaccggcgtgatctatcgtcagttctcgatcaccattgtttcggcgatggtgctg
tcggtgctggtggcgctgatcctcaccccggcgctgtgcgtcaccatcctgaaaccggtc
aaacccggcagtcacggccagcatcgtgggctgtttggttggtttaaccgcaaattcgat
caaagcgcccatcattacaccaacagcgtcgcccgcatgttacatcgcagtggacgttat
ctgttgatttacggcgtgctggtcgcgggtatggcggtgttgtttatgcgtctgcccacc
tcgttcctgccgtcggaagaccagggcgtgctcgccacccaggccatcctgcctgccggt
gcgacgcaggaacgtactcaggcggtgctggatcaggtgaatgattactatctgaagaac
gagaaaaacaacgttgagaacgtactgacggtgaacggcttcggttttgccggacggggt
caaaacgtcgggatcgcctttatcggcctgaaggactggtcacagcgtccgggggaggag
aacaaggtagacggcattgtcagccgtgccgcgaaggcgttcagcaacattatggacggt
aatgtcgtggcctttaacctgccaccaatcattgcgctgggtaacgccaccggcttcgat
tttgagttaattgaccagggtagccttgggcatgacaaactggtcgcagcgcgtaacaaa
ctgctggagctggcacgtcagcatcccgacacgctggtggcggtgcgcccgaacggtatg
gaagatagcccacaatacaagctgaatgttgaccaggaaaaagccacggcgttgggcgtg
gatctctccgacatcaataccaccctgagcagcgcctggggcggcagctatgtcaacgac
ttcgttgaccacggcagggtgaagaaggtctacgtgatgagcgatgcgccttatcgcatg
atgccgaaggatctcgacaattggtacgtgcgcgccagcaacggcaagatggtacctttt
gccagtttctcgacggctgagtgggtgtacggctcaccgcgcctggagcgttataacggt
ttgtcttcactggaaatcctcggtcagccagcagcgggtaaaagctcgggcgaagcgatg
gcactgatggaacagctggcgaaacaactgccacccggcgtcggttatgactggacgggt
atgtcgtaccaggaacgcatgaccggcgagcaggctccggcactgtacgcgctgtcactg
attgtggtgttcctgtgcctggcagcgttgtacgagagttggtcgattccattctcggtg
atgctggtggtgccactgggtgtgtttggtgcgctggtcgccaccctgttgcgtgggctg
aataacgatgtttacttcgtggttggcctgctgaccaccatcggcctgtcagcgaagaac
gccatcctgattgtcgaattcgccaaagaccagatcgagaaagaaggcaaaggtgtggtg
gaagccacgctggaggcggctcgtatgcgtctgcgcccgattctgatgacctcactggcg
tttatccttggtgtcctgccgctggcactcagctccggtgcgggttctggtgcacagaac
gccgtcggcaccggggtcatcggcgggatggtggcggcaaccttgttggctatctatttt
gtaccggtattttttgtggtggtacgtaaccgctttggcggcaagtcccgcgacgatgag
gacgacgacatcctcgtgtaa

DBGET integrated database retrieval system