KEGG   Pantoea sp. At-9b: Pat9b_4237Help
Entry
Pat9b_4237        CDS       T01386                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13979  uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
pao  Pantoea sp. At-9b
Brite
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     Pat9b_4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C Glu_dehyd_C NAD_binding_2 ADH_zinc_N_2 Sacchrp_dh_NADP 3HCDH_N Pyr_redox ApbA ThiF
Motif
Other DBs
NCBI-ProteinID: ADU72801
UniProt: E6WN16
Position
pPAT9B04:complement(112342..113397)
Genome map
AA seq 351 aa AA seqDB search
MTLNVKGYAAFAAKEDLVPHNFVRRDPRDNDVVIEILYSGVCHSDIHNAYNDWGGAKYPM
VPGHEIIGRVTHVGKAVKKFSVGDHVGVGCMVDSCQHCSACEQGLEQYCEEGNTLTYNDV
DRHDHMPTYGGYSDKIVVTEKFVVKVPEGLDLKSAAPLLCAGITTWSPLRHWNVGPGSKV
AVVGLGGLGHMALKFAKALGADVTLFSRSPNKTDDARRLGAEHIVISTDDAQMQAVYNQF
DLIIDTVPYVHDLKPYIPTLALNGTLVLVGYLGDLDPVLNSAPLVLGRKSVAGSVIGGIA
ETQEMMDFCGEHGITSDVEMINMQDINAAWQRMLKSDVKYRFVIDIASLKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaatgtaaaaggctatgccgcttttgctgccaaagaagacctggtgccgcat
aattttgtccgtcgcgatccgcgcgacaatgacgttgtgattgagatcctctacagcggc
gtttgccactccgatattcacaacgcttacaacgattggggtggcgcgaaatatccgatg
gtgcccggccacgaaattatcggtcgcgtcacccatgtgggtaaagccgtgaaaaaattc
agcgttggcgaccatgtcggcgtgggttgtatggtggattcctgccagcattgcagcgcc
tgtgaacagggccttgagcagtattgtgaagaagggaataccctcacctataacgacgtt
gatcgtcatgaccatatgccaacttatggcggttactcggacaaaatcgtggtcacggaa
aaattcgtggtcaaagtaccggaaggtctggatctgaaaagcgccgcgcccctgctgtgc
gccggtatcaccacctggtctccgctgcgtcactggaacgtgggtccgggcagcaaagtt
gctgtagtgggcctcggtgggctgggacatatggcgctgaaatttgccaaggcgctgggt
gccgatgtgaccttgtttagccgttcgccaaataaaactgacgatgctcgtcgcctgggt
gcagagcatatcgtgatttccactgacgacgcgcagatgcaggcggtgtacaaccagttt
gatctgattatcgacaccgtaccttatgtccatgatctgaaaccctatattccaaccctc
gcgttaaacggcacgttggtgctggtgggttatctgggcgatctggacccggtgctgaac
agcgccccgctggtgctgggtcgtaaatcggtcgccggttcggtgattggtggcattgcc
gaaacacaggagatgatggatttctgcggtgagcatggcatcacgtcagacgtagaaatg
atcaacatgcaggatattaatgctgcgtggcagcgcatgttaaaaagcgatgtgaagtat
cgttttgttatcgatattgcctcactgaaggcataa

DBGET integrated database retrieval system