KEGG   Pantoea sp. At-9b: Pat9b_4238Help
Entry
Pat9b_4238        CDS       T01386                                 

Definition
(GenBank) Carboxymuconolactone decarboxylase
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD MerR-DNA-bind
Motif
Other DBs
NCBI-ProteinID: ADU72802
UniProt: E6WN17
Position
pPAT9B04:complement(113422..114078)
Genome map
AA seq 218 aa AA seqDB search
MNTTASLNASQRAIVPIAAWTAKGDLPALSQALNAGLDAGLTLNEVKEVLLQMYAYTGFP
RSLNGITTFMSVVKQRAERGIHDPVGQAPSPLPQDKSRKEIGTEIQTLIAGRELKAEKGN
FIEFLPEINLFLQEHLFADVIARDNLSLADREIATIAALTGLGGVESQLQAHLGGGLNVG
LSEQQIKSLFAVYDNTVNSSEAQRGMQLLDEVMVSRAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgacagcatcactcaatgccagccagcgagccattgttcccattgcagcctgg
actgccaaaggtgatttacccgcactttctcaggctctcaacgcagggttagacgccggt
ctgacccttaatgaagtcaaggaagtgttgctgcaaatgtatgcctacaccggattcccg
agaagcctgaatggtattactacctttatgagcgtggtgaaacaacgtgctgaacgaggt
atccacgatcctgtcggacaagccccatcccccctgccgcaggataaatctcgtaaagag
atagggaccgagattcagacgttaattgccggacgcgaattaaaagccgagaaagggaat
ttcatcgaattcttgccagaaattaacctgttcttgcaagaacatctttttgccgacgtg
attgcccgtgacaacctcagtttagcggatcgcgagatcgccaccattgccgcgctcacc
ggccttggcggggtggaatctcaattgcaagcacaccttggcggcggcctgaatgtcggg
ctgagcgaacaacaaattaaaagcttgtttgcggtctatgacaataccgtcaatagcagt
gaagcccaacgcggtatgcagctattagatgaagtgatggtcagccgcgcacgttag

DBGET integrated database retrieval system