KEGG   Pantoea sp. At-9b: Pat9b_4244Help
Entry
Pat9b_4244        CDS       T01386                                 

Definition
(GenBank) PTS system, beta-glucoside-specific IIABC subunit
  KO
K02755  PTS system, beta-glucoside-specific IIA component [EC:2.7.1.-]
K02756  PTS system, beta-glucoside-specific IIB component [EC:2.7.1.-]
K02757  PTS system, beta-glucoside-specific IIC component
Organism
pao  Pantoea sp. At-9b
Pathway
pao02060  Phosphotransferase system (PTS)
Module
pao_M00271  PTS system, beta-glucoside-specific II component
Brite
KEGG Orthology (KO) [BR:pao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Pat9b_4244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4244
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     Pat9b_4244
Transporters [BR:pao02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Beta-glucoside-specific II component [MD:M00271]
    Pat9b_4244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: ADU72808
UniProt: E6WN23
Position
pPAT9B04:complement(119604..121409)
Genome map
AA seq 601 aa AA seqDB search
MNYQTTAKAVIAHVGGAGNIDHIEHCSTRLRLTLRDNTRIDQPALAAIPGVLGVRINVQC
QIIIGKDVVDVYNAVKALTSGQPASDASSQLSWTARSVDFVISVFQPLVPAIAGGGVLKS
LLILLDLLGWLPRSSESYKVLDNIGSAPLYFLPILVAITTANKLKVNVLVAVSAVSVMVL
PLMSKQLAEGIALFSFDLKNIAYASQVFPAILCVLFYSRAERFFNRYSPAALRIFLSPML
SLLVTVPVTLLILGPLGFELGSGLATVILWLYSKLGFVATGLLAGVLPFMVAAGMHKPMI
PYVVASMGQFSREMLYLPASLAHNIAEAGTCLAIALRSKDKVMRSTALSAGISALCGITE
PALYGITLLNKTALYAVIAASVIGGGFLGWMAVEAFALVSPGLASISMFISPTSPWNILY
ALLGAGLAFAISFIATLFFWREKAVQATNLNHFVTPAEGQLIALAEVQDDVFSAGIMGDG
IAVIPTSGKLFAPANGVISHVFDSGHAVSLLTTQGAEVILHIGIDTIKLNGTGFLPRVTA
GQAVQSGDLLVEFDLDAIRAAGFDPVVVMVITNSERFSFTANAADTPLTLHSPIMTLKES
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaaccacagcaaaagccgttatcgcacatgtcggcggagccggaaatatc
gaccacatcgaacactgctccacccgactacgtctgaccctgcgtgacaacacgcgtatc
gaccagcccgcccttgcggccattccgggcgtactgggggtgcgcatcaatgttcagtgc
caaatcatcattggcaaggatgtggtggacgtctataacgcggtgaaagcgctgacatcc
gggcaacccgccagcgacgccagcagccagctcagttggacggcgcgcagcgtggatttc
gtgatcagtgtctttcagccgctggtgcccgccatcgctggcggcggggtgctgaagtca
ctgttgatcctgctggacttactcggctggctgccgcgcagcagcgagagctataaagtg
ctggataatatcggctccgccccactctattttttgcccatcctggtggccatcaccact
gccaacaaacttaaagtgaatgtgctggtcgcggtatccgccgtgtcggtgatggtgcta
ccgctgatgtcgaagcaactggcggaaggtatcgccctgttctctttcgacctgaaaaat
atcgcctatgcctcacaagtgttccccgccattctgtgcgtactgttttattcccgcgca
gaacggttcttcaatcgctattcccccgcagcgttgcgtattttcctctcgccgatgctg
tccctgttggtgaccgtgccagtgacgctgcttatcctcgggccgctcggttttgagtta
ggttccgggctggccacggtgatcctgtggctctacagcaagctgggatttgtcgccacc
gggctgctggccggggtattaccgtttatggtggcagcgggcatgcacaagccgatgatc
ccctacgtggtcgcatcgatggggcaattctcccgcgagatgctgtacctgccagcttcg
ctggcgcataacattgctgaagcaggcacctgcctggcgattgcgttgcgcagtaaagac
aaggtgatgagatccaccgcgctctctgccgggatttctgccttgtgcggcatcaccgaa
ccggcgctgtacggcattacgctgctgaataaaactgcgctgtacgcggtgattgccgcc
agcgtgattggcggcggcttcctcggctggatggcagtggaagcctttgcgctggtcagc
cccggtctcgccagtatctcaatgtttatctctcccaccagcccgtggaatatcctgtac
gcgttactgggtgccgggctggcgttcgctatctcgtttattgccacgctgtttttctgg
cgggaaaaggccgtacaagcgaccaacctcaaccactttgtcaccccggcggaaggacag
ctgatcgcgctggccgaggtgcaagatgatgttttttccgccggtattatgggcgatggc
atcgcggtgataccgaccagcggcaaactgttcgcgccggccaacggggtcatcagccat
gtttttgacagcgggcatgccgtaagcctgctgacgacgcaaggggcggaagtgattctg
catattggcatcgacaccatcaaactcaacggtacaggttttctgccgcgcgtcactgcg
ggacaagccgttcagtccggtgatctgctggtagagttcgacctcgacgctatccgggca
gcgggttttgatcccgtcgtcgtgatggtgattaccaatagcgagcggttttccttcacc
gccaacgccgctgacaccccgctcacccttcattccccgatcatgacgttaaaggagtct
ctatga

DBGET integrated database retrieval system