KEGG   Pantoea sp. At-9b: Pat9b_4257Help
Entry
Pat9b_4257        CDS       T01386                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
pao  Pantoea sp. At-9b
Module
pao_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pao02000]
    Pat9b_4257
Transporters [BR:pao02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Pat9b_4257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ADU72821
UniProt: E6WN36
Position
pPAT9B04:complement(134111..134995)
Genome map
AA seq 294 aa AA seqDB search
MKVFSFRLLCLAATMATGAFSITTSYAQMTVAKVDAVAALVPPAIKDAGVLRIAVPDIGK
PLAYKEGGSLKGMDVELANAVAQTMGLKAEISLIPFSAALTGLQANKFDISYGEFYVTAE
RLKTADFVSNWQDYSTYLVKKTSGFSPKVLADICGHKMGAMAGSAELATLKTAADKCGSN
AATISAFPSINNAVLALNSGRVDGVLINRGGAQESIRLDQGLDASGAIGGGPTATAVARN
DNSAQLLEALKGAYEHLITSGDYAKILNNNDTAYGAVKTIEVYKEGSTPPTYSF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttcagtttccgtctgttgtgcctggcagccacgatggcgacgggtgcgttt
tctataactacaagctatgcacagatgaccgtcgccaaagtagatgccgttgctgctctg
gttcctcctgctattaaagacgccggggtgctacgcatcgcggtaccggatatcggtaaa
ccactggcttataaagaaggcggcagcttaaaaggaatggatgttgaactggcgaatgcc
gtcgcccaaaccatggggctgaaagcggaaatcagcctgatccccttctccgccgcgttg
accgggttgcaagctaataaatttgatatctcctacggcgagttttatgtcaccgctgaa
cggctgaaaactgcggactttgtctcgaactggcaggattacagtacgtacctggtgaaa
aaaaccagcggtttcagcccgaaagtgttggccgatatttgcggtcataagatgggtgcc
atggccggttccgccgagctggccacattgaaaactgctgccgataaatgtggcagcaat
gccgccaccatcagcgctttcccttccatcaacaatgccgtactggctctgaacagtggt
cgcgttgatggcgtgctgatcaatcgtggcggcgcacaggaatcaattcgactggatcaa
ggtctggatgcctccggtgcgattggtggtggccccactgccaccgcggtggcacggaat
gacaactccgcccaactactggaagcgctcaaaggggcctatgagcatctgatcaccagc
ggtgattacgcgaaaatcctcaataacaacgataccgcctacggtgcggtgaaaaccata
gaagtctataaagaaggctccaccccaccgacttacagcttctga

DBGET integrated database retrieval system