KEGG   Pantoea sp. At-9b: Pat9b_4258Help
Entry
Pat9b_4258        CDS       T01386                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00860  Porphyrin and chlorophyll metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
Module
pao_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pat9b_4258
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Pat9b_4258
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Pat9b_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 FAD_binding_2 HI0933_like FAD_oxidored Pyr_redox_2 Pyr_redox_3 GIDA Thi4 FAD_binding_3 Lycopene_cycl NAD_binding_9 ProSAAS
Motif
Other DBs
NCBI-ProteinID: ADU72822
UniProt: E6WN37
Position
pPAT9B04:135199..136635
Genome map
AA seq 478 aa AA seqDB search
MEVTDFDVIVIGGGPSGCSAAWELRDRNILVLEKTHRLGGRLYSMSRGDYWLNLGGHLFP
PAGSHMRNILHSIGLDVISIPGNKFAIYWGGKVYKPNAVSALPLTMSMTLRERFALAMRG
LKILKAVKGWQEAMKPVIGENNQRRRARVASYLADESFRDFMGPLPKRLEALFQSAARRA
AAEMEDQHAGVGVSLFGAVWAGKGDSMALNLNGGSGRFGEVMMEMLGDRVRYHTTVKSVK
KVGDKVTVVFESEGREQTVTAAEVIVAVPAHFADQIVQDIPDDVRATLKNVQYGPFPTMG
IITDETGPMPYDDIYAITTPDASFDMFFNHANPLRTGPRKPGGSLMVYSGGAPARAMLKL
TDEEIRDRYLADVYKMFPELKGHVKETIVQRWEPGNTYRPAGFDFQPMLSYCERHDVNIH
FAGDYFAEIGNMEIATGTGHEAARRARTHLMAQEAQQLKMRLAALTQRGTLSAVKEKA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgattttgatgtcattgttattggtggtggtccttcaggttgttccgca
gcctgggaattgagagatcgtaatattctcgttctggaaaaaacgcatcgtcttggcggg
cgcctctattccatgtcgcgtggtgattactggcttaacctcggggggcacctgtttccg
ccagccggttcgcatatgcgtaatatcctgcattctattggcctggatgtgatcagcatc
ccgggcaacaaatttgccatctattggggcggcaaagtgtacaaacctaacgcggtatcc
gcgctgccattgaccatgtcgatgacgctgcgggagcgttttgcgctggccatgcgcggc
ttgaaaatccttaaagcggtgaaaggctggcaggaagcgatgaaaccggttatcggtgaa
aacaaccagcgccgtcgcgcccgtgtggcaagttatctggcggatgaatctttccgtgat
tttatggggccactgccgaagcgtcttgaggccttattccagtcggctgcgcgtcgtgcg
gcagctgaaatggaagatcagcatgccggggtcggcgtctcactgttcggggccgtgtgg
gcaggtaaaggtgactcgatggcactcaacctgaacggtggttctggtcgttttggcgaa
gtgatgatggagatgctgggcgaccgcgtgcgctatcacaccacggtgaaatccgtgaag
aaagtgggtgacaaagtcacggtggtgttcgagagcgaaggacgtgagcagacggtgacg
gcagctgaagttattgtcgcggtacctgcgcattttgccgatcagatcgtgcaggatatt
cctgatgatgtgcgtgctacgctgaaaaacgtccagtacggccctttcccgaccatgggg
atcatcaccgatgaaaccggaccgatgccgtatgacgatatctacgccatcaccacgccg
gatgcatccttcgatatgttctttaaccacgccaacccattgcgtaccgggccgcgcaaa
ccgggcggtagcctgatggtttattccggcggtgcgccagcccgtgcgatgctgaagctg
accgatgaagagatccgtgatcgttatctggccgacgtctacaaaatgttcccggaactg
aagggacatgtgaaagagaccattgtgcagcggtgggagccggggaatacctaccgtccg
gcaggcttcgattttcaaccgatgctgagttattgcgaacggcatgatgtgaatattcat
ttcgccggtgattactttgccgagatcggcaatatggaaatcgccaccggaacgggccac
gaggccgcacgccgtgcacgtacccatttaatggcgcaggaagcacagcagctgaaaatg
cgactggctgctctgacgcaacgcggcaccctgtcagcggtaaaggagaaagcatga

DBGET integrated database retrieval system