KEGG   Pantoea sp. At-9b: Pat9b_4260Help
Entry
Pat9b_4260        CDS       T01386                                 

Definition
(GenBank) Biotin carboxylase-like protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_4 DUF2283
Motif
Other DBs
NCBI-ProteinID: ADU72824
UniProt: E6WN39
Position
pPAT9B04:complement(137727..139052)
Genome map
AA seq 441 aa AA seqDB search
MKKAIIFIHPWMWAEDAFEACRRKDYCILAVLTTFETLRIDTHWLTQHADYLIQSGGDAN
KDVFNINRLLRGHNAEAACVVNGLDAALSYADAISRLLNLAPLATKAEIFLNKHTFNTYL
SSRGLSVIPGIEITSLTDVQGKKALLEGIGYPLVAKPSEDTAAMADVRVLYSANELMDYL
RKTLGKKNTYYPDRDIARISVQQYIPATSREFFIDFLTIDGRHCLVGAGEYLYDENRTLK
GIEIYDADSPALPDNVIRYVSDILNASGMLNGFTHNEVFLTKENAVLLVESNPRHCGQPS
STLYKVIYGRHRMDLLLDAIEGVSPSEKEGIVRKGPLARALHLYNFSTERPDTINSDGIV
SEMRILSFKGRERDRLPADFYRTPDRINQISAIVMLVNPSDTQLLIDSNTLRDRETAGTL
FIRSRQSTCQGCCADCQTRNR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccattatttttattcatccctggatgtgggccgaagatgcttttgaggcc
tgtcgccgcaaagattattgcatcctggcagtgcttaccacttttgaaactctacgtatt
gatactcactggctcacccaacacgctgactatctgattcagtctggaggcgacgcaaat
aaagatgtatttaatatcaataggttgcttcgcggacacaacgctgaagcagcctgtgtc
gtaaacggtctggatgccgcattaagttatgcggatgctatcagccgtttgctgaacctg
gcccccctggcgacaaaagctgagatttttttaaacaaacatacttttaatacctacctc
agttcacgagggttgtctgtcattccgggtatagaaataacgtcactcaccgacgtccag
gggaaaaaagcgttacttgagggaattggttatccattagtggctaagccctctgaagat
accgctgcgatggctgatgtcagagtgctctattctgccaatgaattaatggactaccta
cgcaaaacgcttggcaagaaaaacacatattatcctgaccgggacatcgccaggatcagt
gttcagcaatatatcccggccaccagcagagaattctttattgattttctgaccatagat
ggcaggcactgcctggttggagccggagagtatctctatgatgaaaacagaacccttaaa
gggattgaaatctatgacgctgacagcccggccctgcctgacaacgtcatccgctacgtg
tccgatatccttaacgcttcgggtatgcttaacgggttcacccataatgaagtttttctg
accaaagaaaacgccgttctgcttgttgaaagtaatccacgccattgcggccagcccagt
tcaacgctttacaaagtgatctatggcagacaccgcatggatttgttgctggatgccatc
gagggagtctccccgtccgaaaaagaagggattgtcagaaaagggcctttggcccgtgca
ctgcatctttataatttttcgactgaacggcccgacacaataaattccgacgggatagtg
tcagagatgagaattctctcatttaagggtagggaacgagatagacttcctgctgatttc
tatcgcaccccagacagaatcaatcagatttcagccattgtgatgctggtcaacccctcg
gacacacaattactcatcgacagcaacacactccgggacagggaaaccgctggcacgctg
tttattcgctcacgccaatccacatgccagggatgctgcgctgactgtcagactcgaaac
cggtaa

DBGET integrated database retrieval system