KEGG   Pantoea sp. At-9b: Pat9b_4263Help
Entry
Pat9b_4263        CDS       T01386                                 

Definition
(GenBank) Carbamoyltransferase
  KO
K00612  carbamoyltransferase [EC:2.1.3.-]
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pat9b_4263
Enzymes [BR:pao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.-  
     Pat9b_4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carbam_trans_N Carbam_trans_C
Motif
Other DBs
NCBI-ProteinID: ADU72827
UniProt: E6WN42
Position
pPAT9B04:complement(141607..143439)
Genome map
AA seq 610 aa AA seqDB search
MKTYILGLSCFFHDSAAALLCDGEIVAAAQEERFTRIKQDCSFPENAVKFCLQMAGITLA
QVSEIFYYENPEKKFNRIMSTATTSGWSGVKSLFLHVPGWLTDKIHVRKKLRKALSFCGT
SVPEITYIDHHRSHAASAFFPSPYEKALVICIDGVGEWDTTTVWEGDGNRLTKHWEIRFP
HSLGLLYSAFTFYCGFKVDSGEYKLMGLAPYGSPVYVDLIKKHLIQVNPDGSFEMDMSFF
DYATGDQMTSNKFHELFGGPPRMAESELTEREFNLAASVQSVLEEVVLLMARNWQTKTGA
TNLCLAGGVALNCVANGKLAESGIFKNIWVQPASGDSGGSLGAALSGWYEHGNAVRMPEP
EDSMKGSYLGSDYTRDELLAFLTERGAVFTELPDEKLCAEVARILANGNVTGWFQGRMEF
GPRSLGARSILGDARNRQMQTVMNLKIKNRESFRPFAPAVLEEYAQEWFRAKAQSPYMLF
VCPVAEAKRIPTQPDTPRATGLERLNQVRSQIPAVTHVDNSARLQTVNGRYNPLFFRLLS
AFHARTGCPVLVNTSFNVRGEPIVESPENAWVCFMRTSMDYLVLGNFVLRKQDQPAWEEQ
TDWKEHYPLD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttacattcttggtctgtcatgttttttccatgacagtgctgctgcattgctc
tgcgatggagaaattgtcgccgcagctcaggaggagcgattcactcgtatcaaacaggat
tgttcatttcctgagaatgcggtgaagttttgtctgcaaatggcgggaataacgcttgcc
caggtatcggagattttttattacgagaaccccgaaaaaaagtttaaccgcattatgtcc
acagcaaccacgtcggggtggtcaggtgttaagtcgctttttcttcacgtaccaggctgg
ctgaccgacaaaattcatgtccgcaaaaaattaagaaaggcactgagcttctgcggcact
tctgtcccagaaatcacctatatcgatcatcatcgctcccatgcagcatcagcattcttt
ccaagcccttatgaaaaagccttagtaatctgtattgatggcgttggcgagtgggacacg
acaacggtctgggaaggtgacggtaacaggctcacaaaacattgggaaattcgttttccc
cactcccttggtctgctgtattcggcattcaccttctactgtggattcaaagtggattct
ggtgaatacaaactgatgggacttgctccctatggaagcccggtttatgtcgatctgatt
aaaaaacatcttattcaggttaacccggacggcagtttcgagatggatatgtcttttttt
gactatgctaccggcgatcagatgacatcaaacaagtttcatgaattgtttggtggcccg
ccacgtatggctgagagtgaactcactgagcgcgagtttaatctggccgcctcggtgcaa
tccgtacttgaagaagtggtgttactcatggcgcggaactggcagacaaaaaccggggca
accaatctttgtctggccgggggtgttgcgcttaactgcgtggccaatggcaagctggca
gaatcggggatattcaaaaatatctgggtacaacctgcctccggcgacagcggtggttcc
ttgggcgcagccctgtcgggttggtatgaacacggcaatgccgtgcgcatgcctgagcca
gaagacagcatgaagggaagctaccttggaagcgattatacacgtgatgagctcctggca
tttctcactgaacggggcgcagtctttaccgaattgccagatgagaaactttgcgccgaa
gttgcccgtattcttgccaatggcaatgtgacgggctggtttcaggggcggatggaattc
ggtccaagatcgttaggcgcacgttcgatcctcggtgatgcgcgtaatcggcaaatgcag
acagtgatgaacctcaaaattaaaaacagggagtcgtttcgtccatttgcgccagcggtg
ctggaagaatacgcgcaggaatggttccgcgccaaggcacaaagtccgtacatgctattc
gtctgcccggtagcggaagcaaaacgtattcctacacagcccgacactccacgagcaacg
ggcctggagcggctgaaccaggtccgttcccagatccccgcggtcactcatgtggataat
tcggcgcgtctgcaaacggtcaatggccgatataaccctctttttttcagactcctgagt
gcgttccatgcacgtaccggctgcccggtgctggttaatacctcattcaatgttcgggga
gagccgatagtggaatcgccggagaatgcttgggtctgttttatgcgcacctcaatggac
tatctcgtattaggtaactttgttttgcgcaaacaggaccaaccagcgtgggaagaacaa
acagactggaaggaacattatccgctggactaa

DBGET integrated database retrieval system