KEGG   Pantoea sp. At-9b: Pat9b_4268Help
Entry
Pat9b_4268        CDS       T01386                                 

Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00261  Monobactam biosynthesis
pao00300  Lysine biosynthesis
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01230  Biosynthesis of amino acids
Module
pao_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Pat9b_4268
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Pat9b_4268
Enzymes [BR:pao01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Pat9b_4268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ADU72832
UniProt: E6WN47
Position
pPAT9B04:complement(147348..148253)
Genome map
AA seq 301 aa AA seqDB search
MILKGVLSAIVTPFTADGEKIDEAALRKLVEQGIADGVDGFVPAGGTGEFSVLSHDERLR
LVEIVVDQTAGRASVLAHTGATSTREAVAFSKHAQEVGASAVMLATPYYEPIGFNEAFAY
YAGVAEATDLPICAYNFPPATGLHLDVDFLLKLTREIPQVKYVKDSSANIMQMSTLINEH
ANEIHFLNGEDVLMLPALMLKAPGMVMGIANFMAPALAKLHQASQSGDDQTVVTIWRQIY
PLICLLGSGRYNSGVKAACELLGLSVGPVRAPIPQYSSEQKAVLKNVLAEIDPALLTGAA
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatccttaagggtgtactttctgccatcgttacgcctttcaccgccgacggtgaaaaa
atcgatgaagctgcactgcggaagctggttgagcagggtattgcagatggcgtcgacggt
ttcgttcccgcaggcggcaccggtgaattctcggtactgtcccacgacgaacgtttgcgt
ctggtggaaattgtcgtggaccagactgctggtcgtgcctcggtgctggcgcataccggt
gctacctccacacgtgaagctgttgcgttttccaaacacgcccaggaggtgggagccagc
gcggttatgctcgccaccccttattatgagccaatcggctttaatgaagccttcgcctat
tacgcgggcgtcgccgaagccaccgacctgccgatttgtgcttataacttcccaccggcc
accggactacatctggacgtcgattttttattaaaactgacgcgtgaaattccgcaggtg
aaatatgtcaaagactcatcggccaatattatgcagatgagtaccttaataaatgagcat
gccaatgagatccattttcttaatggcgaagatgttttaatgctgccggcattaatgttg
aaagcaccaggcatggtgatgggcattgccaactttatggcaccggcgctggcaaaactg
catcaggcgagtcaaagcggcgatgatcaaacggtggtgacaatctggcgacagatttat
ccgctgatttgcctgctgggttcaggccgctacaacagtggcgtaaaagccgcctgtgaa
ctgctgggactgtctgtcgggccagtgcgcgcaccgattccgcaatacagcagcgaacag
aaagccgtgttgaaaaatgtcctggcagagatcgatccggcattattgaccggcgcggca
cgctaa

DBGET integrated database retrieval system