KEGG   Pantoea sp. At-9b: Pat9b_4269Help
Entry
Pat9b_4269        CDS       T01386                                 

Definition
(GenBank) Proline racemase
  KO
K01777  proline racemase [EC:5.1.1.4]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00330  Arginine and proline metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Pat9b_4269
Enzymes [BR:pao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.4  proline racemase
     Pat9b_4269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_racemase
Motif
Other DBs
NCBI-ProteinID: ADU72833
UniProt: E6WN48
Position
pPAT9B04:complement(148279..149343)
Genome map
AA seq 354 aa AA seqDB search
MNNSRTLPASALAWLERADRQEILAVDSHTCGNPTRIVLSGITLPESVQGVDAARLWLRD
HADHWRRRLVHEPRGGGLTCAVLPIATQEDGCDIGAVIMEPGSYPPMCGHCMIGFASVIV
EMNLLPGLWQDHPQQTTFRIRTPAGPIGITARRTGEHFTTVTMVNVESFVVKTPQPYQVD
GRTLPVELLYGGDYYISVDASQIGLSLERDNATEIVRLARLLRAEYTAGGVCDPLSGDEL
DVYQVLFYHYDATQPQDASIVVVAPPGVIDRSPCGTGTSALFAKLVSEGKVAPDATVTTH
SIIGSTFSVTAQQVRETTDRLYVIPAITSRAYINGFLILAADAEDALADGFPPL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagccgcactttacccgccagcgcgctggcatggctggagcgcgctgatcgc
caggagattctggcggtggattctcatacctgtggcaacccgacacgcatcgttttatcc
ggcatcaccctgccagagagcgtgcagggagtggatgccgcgcgtctttggctacgcgat
catgccgaccactggcggcggcgtctggtgcatgaaccacgcggtggcggcctgacctgt
gcggtactaccgattgccacccaggaagacggctgtgatattggcgcggtgatcatggag
ccaggctcttacccgccgatgtgcggccactgcatgattggttttgcctcggtgattgtc
gaaatgaacctgctaccgggtttgtggcaggaccatccgcagcagacgacgtttcgtatc
cgtaccccagcgggtccgattggcatcaccgcacgccgtacaggtgagcacttcaccacc
gtgaccatggtgaatgtcgagtcgtttgtggtgaaaaccccgcaaccctatcaggttgat
ggccgcaccctaccggttgagttgctgtacggcggcgattactacatctcggtggacgcc
agccagattggcttatcgctggaacgggataacgccacagaaattgtgcggctggcacgc
ctgctgcgcgccgaatataccgccggtggggtatgcgatcctctgtccggtgatgaactg
gatgtctatcaggtgttgttttatcactacgatgccacacaaccgcaggatgccagtatt
gtggtggtggccccacccggggtgatcgatcgttcgccgtgtggtaccggcaccagcgcg
ctgttcgccaagctggtgagcgaaggcaaagtcgcacccgatgccaccgtcactacccac
agtattatcggttcgacctttagtgtcaccgcgcagcaggtgcgcgaaaccaccgatcgt
ttatatgttatcccggccatcaccagccgggcttacattaacggttttcttatccttgct
gccgatgcggaagacgcactcgcagatggttttcccccgctttaa

DBGET integrated database retrieval system