KEGG   Pantoea sp. At-9b: Pat9b_4286Help
Entry
Pat9b_4286        CDS       T01386                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00051  Fructose and mannose metabolism
pao00562  Inositol phosphate metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01230  Biosynthesis of amino acids
Module
pao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pao_M00002  Glycolysis, core module involving three-carbon compounds
pao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_4286
   00051 Fructose and mannose metabolism
    Pat9b_4286
   00562 Inositol phosphate metabolism
    Pat9b_4286
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pat9b_4286
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pat9b_4286
  Exosomal proteins of bladder cancer cells
   Pat9b_4286
  Exosomal proteins of melanoma cells
   Pat9b_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU72850
UniProt: E6WN65
Position
pPAT9B04:complement(167385..168161)
Genome map
AA seq 258 aa AA seqDB search
MAQPQVWLGVSLKMYFGYQQTLAWCRDVADLAQRHPAIQQGDIGLFVLPAFPAIPAVAEI
FANTPVRFGAQDVCQAANGAWTGEVSASMLQELGCSLAEIGHAERRRHFHEDKTQIAAKV
AMALRHDLTPVLCIGEEQEGQPEQAIALCAQQLAEALADAEQQGLRGNLLFAYEPQWAIG
APQPAPDNYIRAVCDGLRQLPTPQGITLQVIYGGSAGPGLIQRLGDSVNGLFLGRFAHDP
QALAQIVDEASVLLQEIR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaccgcaagtgtggctcggcgtcagcctgaaaatgtactttggctatcagcag
acgctggcatggtgtcgggatgtcgccgatttggcacagcgccatccggccattcagcaa
ggtgatatcgggttgtttgtgctgcccgccttcccggcgatcccggcagtggcagagatc
tttgccaatacgccggtacgctttggcgcgcaggatgtctgccaggcagcaaacggtgcc
tggaccggtgaagtcagcgccagcatgttgcaggaactgggctgttcactggctgaaatt
gggcatgccgaacgccgtcgtcatttccatgaagataaaacccaaatcgccgccaaagtg
gcgatggcgctgcgccacgatttaaccccggtgttgtgcatcggcgaagagcaggaaggc
cagcctgagcaagccattgcgctctgcgcacaacaactggcagaagcgttagcagacgcg
gaacaacagggtctgcgcggcaacctgttgtttgcttacgaaccccaatgggcaattggc
gcgccgcagcccgcaccggacaactacattcgggcggtctgtgacggtctgcgccagtta
cccacaccacaaggcattaccttacaggtgatttacggcggcagcgccgggccggggctg
attcaacgtctgggagacagcgtaaacgggctgtttcttggacgtttcgcccatgacccg
caggcgctggcgcagattgttgatgaagccagtgtgcttttacaggagatccgttaa

DBGET integrated database retrieval system