KEGG   Pantoea sp. At-9b: Pat9b_4923Help
Entry
Pat9b_4923        CDS       T01386                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pat9b_4923
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Pat9b_4923
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Pat9b_4923
    1.1.1.-  
     Pat9b_4923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA IGFBP PBP_like
Motif
Other DBs
NCBI-ProteinID: ADU72224
UniProt: E6WLD9
Position
pPAT9B02:complement(195566..196531)
Genome map
AA seq 321 aa AA seqDB search
MKAVRLSGIEQLSVADLPVPVLVPGQVHLRVLAAGICGSDLHNYRTGKWFAHLPVTPGHE
LMGEVIACAPDVSDFRPGDRVVADSRVWCGTCPACARQHYNLCEKLGFVGEVCDGGFAEQ
TLLPARGLMRVADDLPPQIAVLSEPLGVALRVVNQLQLPPGARVRVAGGGTIGGLVALLL
HEVAQCEVQLVEPNVERYQRLANLMPLQHAGPFDFAVEATGINAVLSQLVEDISSGGRIA
LVGLFHHSADFDMNRLVEREIILVGCSVFRDEQRQALALLPQLADKLATLVAPAICLDDV
PDIYPHLIAGRSPWLKTVIVP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgcggttatcaggtattgagcagttgagcgtggcagaccttcccgtgccg
gtgctggtaccggggcaggtgcatcttcgggtgctggcggcggggatttgtggctccgac
ctgcataactatcgtaccggcaaatggtttgcccatctgccggtcacgccggggcacgag
ctgatgggcgaggtgatcgcctgcgccccggacgtcagcgactttcgtcccggtgaccgg
gtggtggccgattcgcgcgtctggtgtggcacgtgtccggcctgtgcccggcaacattac
aacctgtgcgagaaactgggttttgtcggcgaggtgtgtgacggcggcttcgccgagcag
actctgctccctgcgcggggtttaatgcgggtggcggatgatttgccaccacagattgcg
gtactcagcgaaccgctcggcgtcgcgttgcgggtggttaatcaattgcagcttccgcca
ggggcgcgggtgcgagtggccggtggtggcaccatcggcgggctggtggcgttgctgctc
cacgaggtggcgcaatgcgaggtacaactggttgagccgaatgtggaacgttaccagcgg
ctggcgaacctgatgccattgcagcacgctggtccgtttgattttgccgtggaggcgacc
ggtatcaatgcggtactgagtcagctggtggaagacatcagcagcggaggacggattgct
ctagtgggactattccatcattccgctgattttgatatgaaccgcctggtggagagagaa
atcatcctggtggggtgcagcgtgttccgtgatgaacaacgccaggcgctggccctgctg
ccacagttggcggataaactggcgacgctggtcgcgcctgccatctgtcttgatgacgtg
ccggacatctatccacatttgattgccggacgcagcccgtggttaaaaacggtgatcgta
ccatga

DBGET integrated database retrieval system