KEGG   Pantoea sp. At-9b: Pat9b_5112Help
Entry
Pat9b_5112        CDS       T01386                                 

Definition
(GenBank) type-F conjugative transfer system protein TraW
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
pao  Pantoea sp. At-9b
Brite
KEGG Orthology (KO) [BR:pao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pao02044]
    Pat9b_5112
Secretion system [BR:pao02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pat9b_5112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraW_N Ribosomal_L13e
Motif
Other DBs
NCBI-ProteinID: ADU72380
UniProt: E6WLU5
Position
pPAT9B02:379079..379699
Genome map
AA seq 206 aa AA seqDB search
MRPRLAVLLLVLTFPLFTGAKDLGTLGHLFPIAEPDLLTFIGQRLQGMKESGELDRIQRE
AEARVKAHAVRPEPVAGLTPAVKDRSFRYDPTFTVQETIRDMKGNVIARAGDRVNPLDKV
PYSETLYFIDGDNPAQMRWVKQQLTGQQNFKVILVKGNIRDSSLALDEPVYFDQYGTLTT
KFGFEHTPVRVTRDDRWLRVEEVALK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggctggcagtgctgctgcttgtcctgacgttcccgctgttcaccggcgca
aaagacctcggcaccctcggccatctgttcccgattgccgagcctgacctgctgaccttt
atcggtcagcggctgcaggggatgaaggagagcggggagctggacaggatacagcgtgag
gccgaagcgcgggtaaaggcccatgcggtgcggcctgagccggtggcggggctgacgccg
gcggtgaaagaccggtcattccgttatgacccgacctttaccgtgcaggaaaccatccgg
gacatgaagggcaacgtcattgcccgggccggtgaccgggtgaacccgctggataaggtg
ccgtacagcgaaacgctgtacttcatcgacggtgacaatccggcacagatgcgctgggta
aaacagcagctgaccgggcagcagaatttcaaggtcatcctggtgaagggcaatatccgt
gacagcagcctggcgctggacgagccggtgtacttcgaccagtacggcacattaacaacg
aaatttggctttgagcacacgccggtgcgcgtcacgcgcgatgaccggtggctcagggtg
gaggaggtggcactgaaatga

DBGET integrated database retrieval system