KEGG   Pantoea sp. At-9b: Pat9b_5169Help
Entry
Pat9b_5169        CDS       T01386                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00250  Alanine, aspartate and glutamate metabolism
pao00650  Butanoate metabolism
pao00760  Nicotinate and nicotinamide metabolism
pao01100  Metabolic pathways
pao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Pat9b_5169
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pat9b_5169
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pat9b_5169
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Pat9b_5169
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     Pat9b_5169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Claudin_2
Motif
Other DBs
NCBI-ProteinID: ADU71328
UniProt: E6WJR6
Position
pPAT9B01:44773..46149
Genome map
AA seq 458 aa AA seqDB search
MTDNVISRNPTNGEILASWPLQNAAELEISLQQSAQAFSEWRMTSMVQRVQVLRQLAEQI
RQRQDELAAMATLEMGKPIAQARAEVLKCSNLCDWYAEHGPAMLADKPTLVENQQAWQAF
RPLGVILAVMPWNFPYWQVLRGAVSMLLAGNTYLLKHAPSVMGCANLITSLFDATDLPKG
AFTVINVDNDGVSIAIKDPRIAAVAVTGSVRAGGAIAAQAGAVLKKTVLELGGADPFIVL
ADADLDAAVASAVTGRYQNTGQVCMAAKRFIIEESVAEAFEARFSAAVQALNIGDPLEET
TYIGPMARYDLRDELDRQVQQSIAEGARVVTGAHKIEGPGNYYAPTILADVTPEMTAFQQ
EIFGPVAAITVARDAQHALELANNSEFGLSATIWSGNEALANELAQQLETGAVFINGNGA
SDPRVAIGGVKKSGYGRELSSFGVYEFCNVQTVWKNRR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaatgtaatctcacgcaatcctaccaacggtgaaatccttgcaagctggccg
ctacagaatgcagctgaactggaaatttcattacagcaaagcgcacaggcctttagcgaa
tggcgcatgaccagcatggtgcagcgagtccaagtcctgcgccagttggcagagcagatc
cgccaacgtcaggatgaactggctgctatggcaaccctggaaatgggtaaacctatcgct
caggcacgtgctgaggttttgaaatgttccaacctgtgtgactggtatgctgaacatggt
ccggcgatgctggcagataaacccacgctggtggaaaatcagcaggcatggcaggcattt
cgtccactgggtgtgatcctcgctgtgatgccatggaacttcccgtactggcaggtactg
cgtggcgcagtcagcatgttgctggcaggcaacacctacctgttgaaacatgcacccagc
gtgatgggctgtgccaacctgatcaccagcttgttcgatgccactgatttgcccaaaggg
gcattcacggtcattaacgtggataacgacggtgtttccatcgccatcaaagatccgcgt
attgctgcggtcgccgtgactggcagcgtgcgcgcaggtggagccatcgcagcacaagcc
ggggcggtgctgaagaaaaccgtgctggaactgggcggtgccgatccttttatcgtactt
gcggatgcagacctggatgcagcagtggcctcagcggtcacaggacgctatcagaacacc
ggacaggtctgtatggcagccaaacgctttattatcgaagaaagtgtcgctgaggccttt
gaggcgcgttttagcgcagcggtacaggcactgaatattggcgaccctctggaagagaca
acctacatcggccctatggcccgctatgacctgcgagacgaactggatcgccaagtccag
caaagcattgccgaaggtgcccgagtggtaacaggagcgcacaaaatcgaaggcccgggt
aactactatgcgccaaccatcctcgccgatgttacacctgagatgaccgcattccagcag
gagatctttggacccgtggccgccatcactgtggcccgcgatgcacaacatgcgctggaa
ctggcaaacaacagcgagtttggtctgagtgccacgatctggagtggcaacgaggcgctg
gcgaatgaactggcgcagcaactggaaacgggcgcggtatttatcaatggcaatggcgca
tcagatccccgtgtcgccattggcggcgtgaagaaaagcggctatggtcgcgagctgtcc
agctttggcgtctacgaattctgcaacgtccagacggtgtggaaaaatcgtcgctaa

DBGET integrated database retrieval system