KEGG   Pantoea sp. At-9b: Pat9b_5646Help
Entry
Pat9b_5646        CDS       T01386                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00520  Amino sugar and nucleotide sugar metabolism
pao01100  Metabolic pathways
pao01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pao_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_5646
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Pat9b_5646
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pao01005]
    Pat9b_5646
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     Pat9b_5646
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     Pat9b_5646
Lipopolysaccharide biosynthesis proteins [BR:pao01005]
 Unusual sugar
  Pat9b_5646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C NAD_binding_10 3Beta_HSD TrkA_N RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADU71802
UniProt: E6WIX2
Position
pPAT9B01:complement(508897..510876)
Genome map
AA seq 659 aa AA seqDB search
MKTIVFAYHDMGCAGINALLQAGFEISAIFTHPDTAGENHFFGSVARIAAEQGIPVYAPD
DVNHPLWVDRIKAMSPEIIFSFYYRNLLNDAILNSARLGAYNLHGSLLPKYRGRAPLNWV
LVNGETETGVTLHRMVKRADAGDIVAQTRVAIAEQDNVLTLHRKLVQSATQLLEDTLPAM
KRGEINAVPQDEKEATVVGRRTPEDGRIDWSRPATEINNLVRAVTDPWPGAFAYAGTVKF
VVWKGRVHPAAHGAKPGTVLSVEPFLIACGEGALEVVTGQSDNGVYMNGSQLALSLGMVP
SALLYSKPVAAVKRRTRVLILGVNGFIGNHLTERLLQDDNFEVYGLDISSDAISRFLGHP
GFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYKKRIIFPSTSEVYGMCTDRHFDEDNSNLVVGPINKQRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGAQKRCFTDI
RDGVEALFRIIENKQNNCDGQIINIGNPENEASIKELAEQLLASFERHPLRDQFPPFAGF
REVESSSYYGKGYQDVEHRKPSIKNARRLLGWTPEVQMDITIDNTLDFFLRTVELQDKP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcgtcttcgcctaccacgacatgggctgtgcgggcattaatgcgctgctg
caagctggcttcgaaatcagtgccatctttacacaccccgatactgccggtgaaaatcac
ttttttggctcggtggcgcgtattgccgcagaacagggcattccggtgtatgccccggat
gatgtcaatcacccgctgtgggtcgatcgtatcaaagcgatgtcaccggagattattttc
tccttctattatcgcaacctgctgaatgacgcgatcctgaatagcgcccgccttggtgcg
tataacctgcatggctcgttgctgccgaaataccgtggccgtgcgccgctgaattgggtg
ttggtcaacggtgaaaccgaaaccggcgtgaccttgcatcggatggtgaaacgcgcggat
gcgggcgatatcgtggcgcaaacccgggtggcaattgcagagcaggacaacgtgctgacg
ctgcatcgcaaactggtgcagagcgcgacacaactgctggaagacacgttaccggcgatg
aaacgcggtgagattaatgctgtgccgcaggatgagaaagaagccacggtggttgggcgt
cgtaccccggaagatggccgcattgactggtcacgtccggcgaccgagatcaataacctg
gtgcgtgcggtcaccgatccctggccgggagcattcgcctatgccggaacggtgaaattc
gtcgtgtggaaagggcgggtgcatccagctgcgcatggtgcgaaacccggtacggtgtta
tcggtcgaacctttcctcatcgcctgtggtgaaggtgcactggaagtggtgaccggccag
agtgataacggcgtttacatgaacggtagccagttggcgctcagcctcggcatggtgcca
agcgcgttgctgtactcaaaaccggtcgctgcggtgaaacgccgcacccgggttctgatc
ctcggtgtgaatgggtttatcggtaaccacctgaccgaacgcctgttgcaggatgataat
ttcgaagtttacggcctggatatcagttccgatgccatcagccgtttccttggccatcct
gggtttcattttgtcgagggtgatatcagcattcactcggaatggattgaatatcacatc
aagaaatgtgatgtggtgctgccgctggtggcgattgccacgccgattgagtacacccgc
aatccgctccgcgtgtttgagctggatttcgaagagaacctcaaaattatccgtgattgc
gtcaagtacaaaaaacgcatcattttcccatcgacgtcagaagtttacggtatgtgtact
gaccgtcatttcgatgaagataactcgaacctggtggtcgggccgatcaacaaacagcgt
tggatctattccgtttccaagcagttgctggaccgggtgatctgggcctacggtgagaaa
gaagggctgcgttttaccctgttccgtccgtttaactggatgggaccccgtctggataac
ctcaacgcggcgcgtatcggcagttcacgcgcgatcacccagttgattcttaacctggtg
gaaggttcgccgatcaaactgattgacggtggtgcacagaaacgttgcttcaccgatatc
cgtgatggcgttgaagccctgttccgcattatcgaaaacaagcagaacaactgcgacggc
cagattatcaacattggtaacccggaaaacgaagccagtatcaaggagctggcggagcaa
ctgctggccagcttcgagcgccatccgctgcgcgatcagttcccgccgttcgccggtttc
cgcgaagtggaaagcagcagctattacggcaaaggctatcaggatgttgagcatcgtaaa
ccgtcaatcaaaaacgcgcgtcgcctgctgggctggactccagaagtgcagatggatatc
accatcgacaacacgctggacttcttcctgcgcaccgttgagttgcaggataagccatga

DBGET integrated database retrieval system