KEGG   Pseudomonas aeruginosa PA7: PSPA7_0146
Entry
PSPA7_0146        CDS       T00569                                 

Definition
(GenBank) putative phosphoprotein phosphatase
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_0146
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0146
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0146
Enzymes [BR:pap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PSPA7_0146
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSPA7_0146
SSDB
Motif
Pfam: PP2C_2 SpoIIE PP2C
Other DBs
NCBI-ProteinID: ABR83475
UniProt: A6UXK7
Structure
PDB: 
6JKV

Position
complement(159755..160483)
AA seq 242 aa
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGGHAAGDFVSSLIVDTL
RRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGD
SRLYRLRGGVLEAISRDHSYVQELLDNDLISEDEARHHPRANVVTRAVGVHERLELSEAA
LHVLPGDSFLLCSDGLNKTADDSELRDVLGHSDPYAVVRSLVHLGLTRGAPDNITALVVR
AF
NT seq 729 nt   +upstreamnt  +downstreamnt
atggtgcccaactcagtcagctactacagatcggccagctacagccacgtcggcatggtc
cgcaaggtcaacgaggacgccagcctcgacgcccccgagtccgggctctgggtggtcgcc
gacggcatgggcggccacgccgccggcgacttcgtcagcagcctgatcgtcgacaccctg
cggcgcatccccgccgcctcctcgctaccggcctacgtcggcgcgttgcgcaccggcctg
gcccaggtcaacgagcgggtccgccaggaggccggcctgcgcggcgtcagcgtgatgggc
agcaccctggtgctgctcgccgcgcgcggcaaccaggcgagctgcctgtgggccggcgac
agccgcctgtaccgcctgcgcggcggcgtgctggaagccatctcgcgggaccacagctac
gtccaggaactgctcgacaacgacctgatcagcgaggacgaggcgcgccaccatccgcgc
gccaacgtggtcacccgcgcggtcggcgtgcacgagcgactggagctctcggaagccgcg
ctgcacgtgctgcccggcgacagcttcctgctctgcagcgacggcctcaacaagaccgcc
gacgacagcgaactgcgcgacgtgctcggccacagcgatccctacgcggtggtgcgcagc
ctggtccacctgggcctgacccgcggcgccccggacaacatcacggccctggtggtcagg
gccttctga

DBGET integrated database retrieval system