KEGG   Pseudomonas aeruginosa PA7: PSPA7_0147
Entry
PSPA7_0147        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11890  type VI secretion system protein ImpM
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0147
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSPA7_0147
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: ABR84567
UniProt: A6UXK8
Structure
PDB: 
2QNU

Position
complement(160493..161173)
AA seq 226 aa
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRF
AIAPGLLGDDAVAGVVMPSIDRVGRYFPLTVACLLPANADLGALVGGDDGWFEQVEGLLL
STLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAATPAQRLAALAQHACDGA
SHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFPGIPG
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgaacagcgtcggtttctacggcaagctggccggccgcggcgacttcgtcagccgcggc
ctgccgaacaccttcgtcgagccctgggacgcctggctggccagcggcatgcgcgccagc
caggacgaactcggcgcggcctggctcgacgcctacctgaccagcccgctgtggcgcttc
gccatcgcccccggcctgctcggcgacgatgcggtggccggagtggtgatgccgagcatc
gaccgggtcggccgctacttcccgctcaccgtggcctgcctgctgccggcgaacgccgac
ctcggcgcgctggtcggcggcgacgacggctggttcgagcaggtcgagggcctgctgctc
tccaccctcgaaccggaagccgaggtcgaagccttcgagcaggcggtggcgcagctcccg
gcgccgccctgcggcccgcgcatcgagcagtcgctgatcagcggcaacctgctgcgcagc
gaggcggcgaccccggcacagcgcctcgccgccctggcccagcacgcctgcgacggcgcc
agccactggtggggccgcggctcggcgcggatttccgcaggcctgatgcgctaccaggga
ctgccgccggcgccggcgttcggacgatttctcaccggcgagggcgaggtgatcccgctc
tttcccggcatacccggttaa

DBGET integrated database retrieval system