KEGG   Pseudomonas aeruginosa PA7: PSPA7_0148Help
Entry
PSPA7_0148        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_0148
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0148
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C RHH_1
Motif
Other DBs
NCBI-ProteinID: ABR81637
UniProt: A6UXK9
Position
complement(161170..164700)
Genome map
AA seq 1176 aa AA seqDB search
MKGFLNFFTRWVVPVLGLLALSLVIWFLGPLLRLGNYEPLASATSRWVLIALLFLVWIGF
RVLRIVQARRNAAKVMQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVL
LDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERAAH
AQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALDDGK
SAEGPLAGFASEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGEFLNG
VFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIER
LFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVD
QRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLANDAPGWAEGYGLYQGDMLGEESASVY
RKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWER
NLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQRVYDRVKRQR
LPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTASLSQAGTIAE
EQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADVLRILS
GPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGVREQP
QQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNTLYVQVSAMAGASGDSLLGDA
KNQVAAAASRVALSAERQPPVVQGLVKKVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQS
LAGRYPIAAGSSRDATLEDFGHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLG
INPGVLHTFQRAAAIRDAFFRSGGMQPTVRFELKPVTMDAAISQFILDLDGQQLTYDHGP
SRPVAMQWPSANGLGVVRLTVTPAPSSGRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTL
RLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcttcctcaacttcttcacgcgctgggtggtgccggtgctcggcctgctcgct
ctgagcctggtcatctggttcctcggcccgctgctgcgcctgggcaactacgagccgctg
gcctcggcgaccagccgctgggtgctgatcgccctgctgttcctggtctggatcggcttc
cgcgtgctgcgcatcgtgcaggcccggcgcaacgcggcgaaggtcatgcagagtctcgcc
gaggtcagcgcgccggacgccgccagcgtcgccaccgccgaagagctggcgaccctcaag
caacgcatggacgaggccctggccctgctcaagcgggccaagctgggcggcagcgagcgg
cgcaacctgtacgagctgccctggtacgtgatcatcggcccgcccggttcgggcaagacc
accgcgctgatgaactccggcctggacttcccgctcgccgcgcagatgggcgccggggcg
atccgcggggtcggcggcacgcgcaactgcgactggtggttcaccgacgaagcggtgctg
ctggacaccgccggccgctataccacccaggacagccacgcccaggtggacaaggccgcc
tggctgggcttcctcgacctgctcaagacccagcgcaagcgccgtcccatcgatggcgcg
ttcatcgccatcagcctctccgacctgctgctgggcagcgacgccgagcgcgccgcccac
gcccaggcgatccgcgcgcggatccaggagctgtaccagcagctcggcgtgcgcttcccg
atctacgtgatgctgaccaagttcgacctggtgccgggcttcatggagttcttcgacagc
ctgaaccgcgaggagcgcgcccaggtctggggaatgaccttcgccctcgacgacggcaag
agcgcggaaggcccgctggcgggtttcgccagcgagttcgcgctgctcgagcagcgcctc
accgcgcgcctggtcgagcgcctgcagcaggaacgcgacccggcgcggcgcgacctggtc
tacggcttcccgcagcagttcgccgccctgcgcgagtgcctcggcgagttcctcaatggc
gtgttcaagcccaacccctacgaggaacgcccgctgttgcgcggcctgtacttcaccagc
ggaacccaggaaggcagcccgatcgaccgcctgatcggcagcatggcgcagtcgatgaac
ctcgaccgccagcacctggcgcggcagaccggcaccgggcgcagctacttcatcgagcgg
ctgttccgcgaagtggcgttcggcgagcgcgggctggtcggcaccaacccgaaggtcgag
cgccgccgcaagtggctgaccatcggcgcgctgagcgccaccgcgctggtggtgctggcg
gtgacggcggtatggatcgccagctaccgcgccaaccagagctacatcgccgcggtcgac
cagcgcgtcgacccgctggcgcgcggcatcgagtcgctgagtccggcgcagcgcgacgtg
ctcgccgtgctgccgcagctcaacgcggtgcagaacctcgccaacgacgcgccgggctgg
gccgaaggctacgggctgtaccagggcgacatgctcggcgaggagtccgccagcgtctac
cgcaagctgctgatcgcggtgttcgccccgcgcctggtgacccgcatcgaggaacagctg
cgctccggcggcagcagcgacttcctctacgagggcctgaaggcctacctgatgctcggt
agccccgaccactacgacgccgacttcatcaaggcctggatcagcctcgactgggaacgc
aacctgccgcgcgacctctcgccggaacagcgccaggcgctgcacgcgcacctcgacgcg
ttgctcgagcggcggccgccgtcggcgcgcctggaccaggacctggtcgaggacctgcgc
cgccagttgcagcaactgccggtggcgcagcgggtctacgaccgggtcaagcggcagagg
ctgcccaaggacgtgcccgacttccgcatcagcgacgccgccggccgcgacgcgccgctg
gtgttcgcgcgcaagagcggcaagccgctcaccgacccgctcagcggcttcttcacctac
cgcggctaccgcgaggtgttcctcaccgccagcctcagccaggccggcaccatcgccgag
gaacagtgggtgctcgggcgcgacctgaacgatgccggcgacgccgccaacctggccctc
gacgtgcgtcgcctgtacttccaggactacctgcggcagtgggacgacctgctcgccgac
ctcaccgtggtgccgatcaccaacgtcacccaggccgccgacgtgctgcgcatcctttcc
ggaccgacctcgccgttccgcaagctgctcgaggcggtggcccgcgagaccgacctgcag
aaaggcgaccggctggtcgccgcgcaggtgaagaaggccgccgacggcaccgtggacaag
ctcaagcagcgcctcggctcgctggtcggccaggaagaggagggcgtccgcgaacagccg
caacaggccgacagcgacccgatcagcgcgcacttcgccgaactcaacagcctggtcagc
aagggcgagggcggcaacgagccagcgccgatcgacagcctgctggaggacatgaacacc
ctctacgtacaggtcagcgccatggccggagccagcggcgactcgctgctcggcgacgcc
aagaaccaggtggccgccgccgcctcgcgcgtggccctgagcgccgagcgccagccgccg
gtggtccagggcctggtgaagaaggtggtcaactccaccaccagcagcatgatgggcagc
gtgcgcaaccagctcaacgcggcgtggatcagcgacgtggtcagcgtctaccggcaatcc
ctggccgggcgctacccgatcgccgccggcagctcgcgcgacgccaccctggaggacttc
ggccacttcttcggggccggcggggtgatggacagctacttccgccagtacctgcaaccc
tacgtcgacacctccgccagcacctggcgctggcagcccggcgcggcgcagaagctcggc
atcaaccccggcgtgctgcacaccttccagcgcgcggcggcgatccgcgacgccttcttc
cgctccggcggcatgcaaccgacggtgcgcttcgagctcaagccggtgaccatggacgcg
gcgatcagccagttcatcctcgacctcgacggccagcaactgacctacgaccacggcccg
agccgcccggtggcgatgcagtggccgagcgccaacggcctcggcgtggtccgcctgacc
gtgacgccggcgcccagcagcggccgctccgggctgaccctggaaggcccctgggcctgg
ttccgcctgctcgaccagtcggacctggagcgcggcaactcgccggaccgcttcaccctg
cggctgcgcatcgacggctccagcatcgcctgcgaactgcgcgccagcagcgccttcaac
cccttcaagagccgggtcgtgtccggtttcagcctcccggagcgcctttga

DBGET integrated database retrieval system