KEGG   Pseudomonas aeruginosa PA7: PSPA7_0154
Entry
PSPA7_0154        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0154
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0154
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABR81447
UniProt: A6UXL5
Position
169807..170838
AA seq 343 aa
MLDVPVLLAAVAPDSPCGEDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRAL
ACELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLDQYWDGVYPLLDADDDNDP
TFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGA
FADADADALAATRRALEGAQEHALAIEGGVAERVGSAQGLDLAPLRQLLRQALQVFDLYG
PQGAGASVVPGAEAAPAEEPGAAPVAAAVPAARASGEIGNREDVLRQLDRLLEYYVRHEP
SSPVPVLLKRAKTLVTADFAEIVRNLIPDGITQFETLRGPENE
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgctggatgtacccgttttgctggccgccgtagccccggactcgccctgtggcgaggac
ctggagtacgacgccgccttcctcgagctcgaacgcatcgcccagggccagcccgagcgg
cagatgggcgacgccgtgttgcccgccgaaccgccggagtggccgcgcgtgcgcgcgctg
gcctgcgagctgttcggccgcagcaaggacctgcgggtggccaacctgctgctgcagagc
aatgtcgccctcgacggcctggacgggctcgccgagggcctgttgctggtccgcgaactg
ctcgaccagtactgggacggggtctatccgctgctcgacgccgatgacgacaacgacccc
accttccgcatcaacgccctcaccggcctggtcgccgagccgctgctgcaactggtctgg
gcgatcccgctggtgcgctcgcgggcgttcggcccggtcaacctgcgcgccgcgctgaac
gccgccggcctgcaacgcttcgccagcgagaccctgagccccgagcagatcgccggcgcc
ttcgccgatgccgacgccgatgcgctggccgccacccggcgcgccctggaaggcgcccag
gaacatgccctggccatcgagggcggtgtcgccgaacgggtcggctcggcccagggcctc
gacctcgccccccttcgccaactgcttcgccaggccctccaggtgttcgacctgtacggc
ccgcagggcgccggcgcatccgtcgtgccgggcgccgaagcggcccccgccgaagagccc
ggcgcagcgcctgtcgccgccgccgtgccggcagcgcgcgccagcggcgagatcggcaac
cgcgaggatgtcctgcgccagctcgaccgcctgctcgagtattacgttcgccacgagcca
tcgagcccggtgccggtgctgctcaagcgcgccaagacgctggtgacggcggacttcgcc
gaaatcgtgagaaatctcatccccgatgggatcactcagttcgaaaccctgcggggcccg
gagaacgagtaa

DBGET integrated database retrieval system