KEGG   Pseudomonas aeruginosa PA7: PSPA7_0155
Entry
PSPA7_0155        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSPA7_0155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0155
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0155
SSDB
Motif
Pfam: T6SS_VipA Herpes_UL69
Other DBs
NCBI-ProteinID: ABR80663
UniProt: A6UXL6
Structure
PDB: 
4UQY 4UQZ 5N8N

Position
170927..171445
AA seq 172 aa
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADR
KFLEIDADNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLN
KLLEARTQLANLLTYMDGKTGAEDMIMKAIKDPALLQALASAPKPKDDEPQA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggaagcactaccagcagtcagaagttcatcgccaggaaccgggcgccacgcgtgcag
atcgagtacgacgtggagctgtacggcgccgagaagaaggtccaactgcccttcgtcatg
ggcgtgatggcggacctcgccggcaagcccgccgagccccaggcggcggtcgccgaccgc
aagttcctggagatcgacgcggacaacttcgacgcccggctcaaggcgatgaagccgcgg
gtggccttcaacgtgccgaacgtgctgaccggcgaaggcaacctgagcctggacatcacc
ttcgagagcatggacgacttcagccccgccgcggtggcgcgcaaggtcgactcgctgaac
aagctgctcgaggcgcgcacccagctggccaacctgctgacctacatggacggcaagacc
ggcgccgaggacatgatcatgaaggcgatcaaggacccggccctgttgcaggccctggcc
agcgcaccgaagcccaaagacgacgagccgcaggcgtaa

DBGET integrated database retrieval system