KEGG   Pseudomonas aeruginosa PA7: PSPA7_0163Help
Entry
PSPA7_0163        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_0163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0163
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V
Motif
Other DBs
NCBI-ProteinID: ABR84753
UniProt: A6UXM4
Structure
PDB: 

Position
180575..182515
Genome map
AA seq 646 aa AA seqDB search
MGLMQLTRLVQVDCPLGADVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMS
LSLELPGGGRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEI
IRQVFRDLGFSDFEDALTRPYREWEYCVQYRESSFDFVSRLMEQEGIYYWFRHEQKRHIL
VLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGAR
LEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEALQAQHERVRLRGVVRGLGA
GHLFRLSGYPREDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLP
QTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLIVGHDRNKSVGNDELARIGHNRT
RAVKLNDTLLVGGAKSDSVSGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYAS
GNGNIDTGGRLDLNSGGASEVDANGKGVQGTIDGQVQAMFPPPPKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgggattgatgcaactgacccgcctggtccaggtggattgcccgctgggggcggacgtg
ctgctgttgcagcgcatggagggccgcgaggaactggggcggctgttcgcctacgagctg
cacctggtctcggagaaccccaacctgccgctggaacagttgctcggcaagccgatgagc
ctctcgctggagctgcccggcggcggccggcgcttcttccacggcatcgtcgcgcgctgc
agccaggtggccgggcacggccagttcgccggctaccaggccaccctgcggccctggccg
tggctgctgacgcggacctcggactgccggatcttccagaaccagagcgtgccggagatc
atcaggcaggtattccgcgacctcggcttttccgatttcgaggatgccctcacgcgcccc
taccgcgagtgggaatactgcgtgcagtaccgcgagagcagcttcgacttcgtcagccgg
ctgatggaacaggagggcatctactactggttccgccatgagcagaagcgccacatcctg
gtgctctccgacgcctacggcgcgcatcgcagcccgggtggctacgccagcgtgccgtac
tacccgccgaccctcggccatcgcgagcgcgaccacttcttcgactggcagatggcacgc
gaggtccagcctggttcgctgaccctcaacgactacgacttccagcgccccggcgcgcgc
ctggaggtgcgttcgaacatcgcccggccgcacgcggcggccgactacccgctgtacgac
tatcccggcgagtacgtgcagagccaggacggcgagcagtacgcgcgcaaccgcatcgag
gcgctccaggcgcagcacgagcgcgtgcgcctgcgcggcgtggtgcgcggcctcggcgcc
gggcacctgttccgcctgagcggttatccgcgcgaagaccagaaccgcgagtacctggtg
gtcggcgccgaataccgggtggtccaggagctctacgaaaccggcagcggcggcgccggc
tcgcagttcgagagcgagctggactgcatcgacgccagccagtcgttccgtctcttgccg
cagactccggtgccggtggtgcgcggtccgcagaccgcggtggtggtcgggcccaagggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccac
gaccagtcgaacgagaacagctcctgctggatccgcgtgtcccaggcctgggccgggaag
aactggggttcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccc
tacgagctgccggcgaacgccacccagagcgggatgaagagccgttcgagcaagggcggc
acgccggccaacttcaacgagatccgcatggaggacaagaagggcgccgagcagttgtac
atccatgccgaacgcaaccaggacaacctggtggagaacgacgcctcgctgatcgtcggc
cacgaccgcaacaagagcgtcggcaacgacgaactggcgcgcatcggccacaaccgcacc
cgcgcggtgaagctcaacgacaccctgctggtgggcggggcgaagagcgatagcgtcagc
ggcacctacctgatcgaggccggcgcgcagatccgcctggtctgcggcaagagcgtggtg
gagttcaacgccgacggcaccatcaacatctccggcagcgccttcaacctctacgccagc
ggcaacggcaacatcgacaccggcggccgcctcgacctcaattccggcggcgccagcgag
gtcgacgccaacggcaagggcgtgcagggcaccatcgacggccaggtgcaggcgatgttc
ccgccgccgccgaaggcctga

DBGET integrated database retrieval system