KEGG   Pseudomonas aeruginosa PA7: PSPA7_0167
Entry
PSPA7_0167        CDS       T00569                                 

Definition
(GenBank) paar motif family
Organism
pap  Pseudomonas aeruginosa PA7
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ABR82927
UniProt: A6UXM8
Structure
PDB: 
6OX6

Position
complement(183308..184612)
AA seq 434 aa
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGL
SMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPF
PVIIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTG
LEALGLAALAGGLLLAAMAGVAALAGFVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVA
GMALLGFGPKMARLGRASAAGEVRTPAYKRGRTEADILGLAKGKRPPPSEYLKKSYIDKH
LKVFKEEGGAFLFTTDDIANPNYTSFNPNKFVMAKSDLNSVVAEYKRTGDVSVLESALGY
DPGSLAGKEIYMLNLENPKVLMPTGNEGGVNSLWRPGGLTHPGGMREAVLDNVAIPHGND
VNVLMSTHDIARIQ
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggatgcgcaagccgccgcccgcctgggcgacgagatcgcccacggcttcggtgtcgcc
gcgatggtcgccggggccgtggccggagccctgatcggcgccgccgtggtcgccgccact
gccgccaccggcggcctggccgcggtgatcctggccggctcgatcgccgccggcgggctg
tcgatgttccagatcgtcaagggcctgaccactatcttcgagctgcccgaacccaccacc
ggggtgctcatacgcggcagcttcaatgtctacgtgaacagccgcaacgcgatgcgcgcc
ggcgacgacgtctccgccacctgcagcggcctgccgctgaaccatccgctgtggccgttc
ccggtgatcatcgccgagggcagcgccaccgtgtacatcaacggcaagcccgccgcgcgc
ttgcagagcaagatggtctgcggcgcgcacatcaagaccggcagccaggacaccttcatc
ggcggccccaccgagcgggtggccttcgtcctcgacctggaggaatggctgcacaccgga
ctcgaggcgctgggcctggcggcccttgccggcggcctgctgctggcggcgatggccggg
gtcgcggcgctggccggtttcgtcgccatcggcgggctgatgatgggcggcatggccctg
ctcggcgaccttggcgatcgcctcggtcccggttaccgcgatctgttccagggcgtggcg
gggatggcattgctgggcttcgggccgaagatggcccggctcggccgggcctcggcggcc
ggcgaggtacgcacgcccgcctacaagcgcggcaggaccgaagcggatatcctgggcctg
gccaagggcaagcggccgcctcccagcgagtacctgaagaagtcctatatcgacaagcac
ctgaaggtgttcaaggaagagggcggcgccttccttttcaccaccgacgacatcgccaac
ccgaactacacctcgttcaacccgaacaagttcgtcatggccaagtccgacctgaactcc
gtggtcgccgagtacaagcgcaccggcgacgtctccgtgctggagtcggcgctggggtac
gatccaggctcgctggccggcaaggagatctacatgctgaacctggagaacccgaaggtg
ctgatgccgaccggcaacgagggcggggtcaactcgctgtggcggcccggcggcctcacc
cacccgggcggcatgcgcgaagcggttctggacaatgtggcgatcccccatggaaacgat
gtaaacgtactgatgtcgacccacgacatcgcgagaatccaatga

DBGET integrated database retrieval system