KEGG   Pseudomonas aeruginosa PA7: PSPA7_0169
Entry
PSPA7_0169        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_0169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_0169
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_0169
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V Dev_Cell_Death
Other DBs
NCBI-ProteinID: ABR81056
UniProt: A6UXN0
Position
185315..187540
AA seq 741 aa
MALAQQTRLVRVDSPLGADVLQLQRMEGREELGRPFAYELELISEDPDLQLDGLLGKPAS
LALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDI
IKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHIL
VLSDAYGAHRSPPGYASVPYYPPTLEQRERDHFYDWHMAREVQSGSLSLNDYDFQRPGAR
LEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEALQARYERVRLRGRARGLGS
GHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCIDGGQAYRPLP
TTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRSKTIDHDETVHVKHDRT
ETVDNNETLTIGVDRTEKVGNNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIG
ANRTEDVGNDETISIGANRSESVGNNETISIGADRSESVGANESIDIGGNQSTSIGKNES
RSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASIRMKKDGSIVISGKNITIDGS
GAINIKADKNVVMKGRKILQN
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcacttgcgcaacagacccgcctggtccgggtggacagtccgctcggtgcggatgtc
ctgcaactgcagcgaatggagggtcgcgaagaactcggccggccgttcgcctacgagctg
gaactgatctcggaagaccccgacctgcagctcgacggcctgctgggcaagccggccagc
ctggcgctggagctgcacgatggcagccggcgccacttccacggcatcgtcgccgcctgc
agccagggttccggcaatggccagttcgccagttaccaggtcaccctgcggccctggctg
tggctgctcacgcgcacctccgactgccgtatcttccagaaccagaaggtcccggacatc
atcaagcaggtgttccgcgacctcggcttctccgacttcgaggatgccctgagtcgctcc
tatcgcgaatgggaatactgcgtgcagtaccgcgagaccagcttcgatttcgtcagccgg
ctgatggagcaggagggcatctactactggttccgccacgagcagagccgtcacatcctg
gtgctctccgacgcctatggcgcgcaccggagcccgccgggctacgccagcgtgccctac
tacccgccgaccctggagcagcgcgagcgcgaccacttctacgactggcacatggcgcgc
gaggtgcagtccggctcgctgagcctcaacgactacgacttccagcgccccggcgcgcgc
ctggaagtgcgctcgaacatcgcccgttcgcatgcggcggccgactacccgctgtacgac
taccccggcgagtacgtgcagagccaggacggcgagcagtatgcgcggacccgcatcgag
gcgttgcaggcgcgttacgagcgggtgcgcctgcgcggccgcgcccgtggcctgggttcc
ggccatctgttcaagctcagcggctacccgcgcgaggaccagaatcgcgagtacctggtg
gtcggcgccgagtatcgggtggtccaggaactctacgagaccggcggcggcggggtcggc
gcacagttcgagagcgagctggattgcatcgatggcggccaggcctaccgccccttgccg
accaccccgttgccgatcgtccgcggcccgcagaccgcggtggtggtcgggcccaagggc
gaggagatctggaccgatcagtacggccgggtcaaggtgcacttccactgggaccgccac
gaccagtcgaacgagaacagctcctgctggatgcgcgtgtcccaggcctgggccgggaag
aactggggctcgatccagatcccgcggatcggccaggaggtaatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccc
tacgagctgccggcgaacgccacccagagcgggatgaagagccgctcgagcaagggcggc
acgccggccaacttcaacgagatccgcatggaggacaagaagggcgccgagcagttgttc
atccacgcggagaagaaccaggacatcgaggtcgagaacgacgagacccactgggtcggc
cacgatcgcagcaagaccatcgaccacgacgaaaccgtgcacgtgaagcacgatcgcacc
gagaccgtggacaacaacgagaccctcaccatcggcgtcgatcgcaccgagaaggtcggc
aacaacgagaagatcagcatcggcgcgaaccgcaccgaggacgtcggcagcaacgagacc
atcagcatcggcgtcgaccgcaccgagaaggtcggcagcaacgagaagatcagcatcggc
gccaatcgcaccgaggatgtcggcaacgacgagaccatcagcatcggcgccaaccgcagc
gagtcggtgggcaacaacgagacgatcagcatcggcgccgaccgtagcgaatcggtgggc
gccaacgagagcatcgatatcggcggcaaccagagcacgagcatcggcaagaacgagtcg
cgcagcgtcggccagggccgcgatacctcggtgggcaaggacgatagcctggacgtgggc
aagagcttcacgctcaatgccggcgactcgatcactctggtcaccggcgctgccagcatc
cgcatgaagaaggacggcagcatcgtcatcagcggcaagaacatcaccatcgacggttcc
ggggcgatcaacatcaaggccgacaagaacgtggtgatgaagggtcgcaagattctccag
aactga

DBGET integrated database retrieval system