KEGG   Pseudomonas aeruginosa PA7: PSPA7_0440
Entry
PSPA7_0440        CDS       T00569                                 
Symbol
glpQ
Name
(GenBank) glycerophosphoryl diester phosphodiesterase, periplasmic
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PSPA7_0440 (glpQ)
Enzymes [BR:pap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     PSPA7_0440 (glpQ)
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-ProteinID: ABR83952
UniProt: A6UYF0
Position
complement(448624..449781)
AA seq 385 aa
MQSAFLRRQLGAACLLLAAGLASAASASADTGNVQRAIDWAQGQASARHPAGQERSPLVI
AHRGASGYVPEHTLGAYALAVMMGADYIEPDLVMTRDGKMVARHDNELGLTTDVARHPEF
ADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPGNARLDGTFEIPTLQEIID
LVKSLQISQQRSIGLYPEIKHGTHFQRLGLAMERPLVKTLHRNGYLGPSAPVFIQSFEVN
NLKELKRLTGIRLIQLYGSGQPYDQQATGGSLTYAEMATAKGLRQVARYAYGVGPDKSYV
IPRDANDNLGQPTRFVGDAHAAGLKVHPYTFRAENSFLPAEFRSADGNPQSRGDLAGEIR
AYLDAGIDGLFSDQPDVAVRLREQR
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcaatcagccttcctgcgccgccagctcggcgccgcctgcctgctgctcgccgctggc
ctggccagcgccgcctccgcctccgccgacaccggcaatgtgcaacgcgccatcgactgg
gcccagggccaggcctccgcccgccacccggccggccaggagcgctcgccgctggtcatc
gcccaccggggcgccagtggttacgtaccggaacacaccctgggcgcctacgccctggcg
gtgatgatgggcgccgactacatcgagccggacctggtgatgacccgcgacggcaagatg
gtcgcgcgccacgacaacgagctgggcctgaccaccgatgtcgcccggcaccccgaattc
gccgaccgcaagcgcacgcagaaagtcgacggagtggaactcaccggctggttcagcgaa
gacttcaccctcgccgaactgaagaccctgcgcgccatcgagcgcatccccacgatccgc
ccgggcaatgcgcgcctggacggcaccttcgagattcccaccctgcaggagatcatcgac
ctggtgaaaagcctgcaaatcagccagcagcgcagcatcggcctgtacccggagatcaag
cacggcacccacttccagcgcctcggcctggccatggagcgtccgctggtgaagaccctg
caccgcaacggctacctcggtccgagcgcgccggtattcatccagtccttcgaggtgaac
aacctgaaggaactcaagcgcctcaccggcatccgcctgatccagctctacggcagcggc
cagccctatgaccagcaggccaccggcggcagcttgacctacgccgagatggccaccgcc
aagggcctgcgccaagtggcgcgctacgcctacggggtcggtccggacaagagctacgtg
attccccgcgatgccaacgacaacctcggccagccgacccgcttcgtcggcgacgcccac
gccgccgggctgaaggtgcatccctacaccttccgcgcggaaaacagcttccttccggcg
gaattccgcagcgccgacggcaacccgcagtcgcgtggcgacctggccggcgagatcagg
gcctacctcgacgccggcatcgacggcctgttcagcgaccagccggacgtcgccgtgcgc
ctgcgcgaacagcgctga

DBGET integrated database retrieval system