KEGG   Pseudomonas aeruginosa PA7: PSPA7_1481Help
Entry
PSPA7_1481        CDS       T00569                                 

Gene name
glnD
Definition
(GenBank) protein-P-II uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSPA7_1481 (glnD)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     PSPA7_1481 (glnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT NTP_transf_2 DUF294 GlnE ACT_6 PPC
Motif
Other DBs
NCBI-ProteinID: ABR85358
UniProt: A6V1D0
Position
complement(1501950..1504652)
Genome map
AA seq 900 aa AA seqDB search
MPQVDPELFDRGQFQAELALKSSPIAAFKKAIRQFREVLDNRFNSGRDIRRLIEDRAWCV
DQVLQQAWQRFDWGDDADIALIAVGGYGRGELHPYSDVDLLILLDSEDQESFREPIEGFL
TLLWDIGLEVGQSVRSVRQCAEEARADLTVITTLMECRTICGPDSLRQRMLEVTGSTRMW
PSKEFFLAKRHEQQRRHAKYNDTEYNLEPNVKGSPGGLRDIQTILWMARRQFGSLNLHAL
VREGFLVESECSMLASSQEFLWRVRYALHMLAGRAEDRLLFDHQRSIARLFGYEDNDVKL
AVERFMQKYYRVVMAISELNDLIVQHFEEVILPCEQPVQIQPLNSRFQLRDGYIEVTHPN
VFKRTPFALLEIFVLMAQHPEIKGVRADTIRLLRDSRHLIDDEFRHDIRNTSLFIELFKS
SQGIHRNLRRMNRYGILGRYLPEFGHIIGQMQHDLFHIYTVDAHTLNLIKHLRKLNRPEM
AEKYPLASKIIDRLPKPELIYIAGLYHDIAKGRGGDHSELGAVDAEAFCQSHQLPLWDTQ
LVSWLVQNHLVMSTTAQRKDLSDPQVIFDFAQLVGDQTHLDYLYVLTVADINATNPTLWN
SWRASLLRQLYTETKRALRRGLENPVDREEQIRQTQTAALDQLVRNGIDQDDAEQLWSQL
GDDYFLRHTAGDVAWHTEAILQHPDDGTPLVLIKETTQREFESGSQIFIYAADQHDFFAV
TVAAMDQLNLSIQDARIITSTSQFTLDTYIVLDADGDSIGNNPERIAEIREGLIDALKNP
DDYPTIIQRRVPRQLKHFAFAPQVTISTDALRQVSVLEVIAPDRPGLLARIGGIFLDFDL
SVQNAKIATLGERVEDVFYITDARNQPLADPDLCKRLQAALVEQLSQDNGRDTLPTRINF
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtggatcccgaattgttcgatcgcgggcagttccaggcggaactggccttg
aagtccagcccgatcgccgccttcaagaaggccatccggcaattccgcgaagtgctcgac
aaccgcttcaacagcggccgcgatatccgccgcctgatcgaagatcgcgcctggtgcgtc
gaccaggtcctgcaacaggcctggcagcgcttcgactggggagacgacgccgacatcgcc
ctgatcgccgtgggcggctacggccgcggcgaactgcacccctactccgacgtcgacctg
ctgatcctcctcgacagcgaggaccaggagagcttccgcgaaccgatcgaaggctttctc
accctgctctgggacatcggcctggaggtcggccagagcgtgcgctcggtacggcaatgc
gccgaggaagcgcgcgccgacctgacggtgatcaccaccctgatggagtgccgtaccatc
tgcggcccggacagcctgcgccagcgcatgctggaagtgaccggcagcacgcgcatgtgg
ccgagcaaggaattcttcctggccaagcgccatgagcaacagcgccgccacgccaagtac
aacgacaccgagtacaacctggaacccaacgtcaagggctcgcccggcggcctgcgcgat
atccagaccatcctctggatggcccgccgccagttcggcagcctcaacctgcatgccctg
gtgcgcgaaggcttcctggtggaaagcgaatgcagcatgctcgcctccagccaggagttc
ctctggcgggtccgctatgccctgcacatgctcgccgggcgcgccgaggaccgcctgctg
ttcgaccaccagcgcagcatcgcccgccttttcggctacgaggacaacgacgtcaagctg
gcggtcgaacgtttcatgcagaagtactaccgggtggtgatggcgatctccgagctgaac
gacctgatcgtccagcacttcgaggaagtcatcctgccctgcgagcagccggtgcagatc
cagccgctgaacagtcgcttccagttgcgcgacggctacatcgaggtgacgcacccgaac
gtcttcaagcgcaccccgttcgccctcctggaaatcttcgtgctgatggcccagcacccg
gaaatcaagggcgtgcgcgccgacaccattcgcctgctgcgcgacagccgacacctgatc
gacgacgagttccgccacgacatccgcaacaccagcctgttcatcgagctgttcaagagc
agccagggtatccaccgcaacctgcggcggatgaaccgctacggcatcctcggccgctac
ctgccggagttcggccatatcatcgggcagatgcagcacgacctgttccatatctatacg
gtggacgcccacaccctcaacctgatcaagcacctgcgcaagctgaatcggccggagatg
gccgagaaatatccgctggcgagcaagatcatcgatcgtctgcccaagccggaactgatc
tacatcgctggcctctaccacgacatcgccaagggccgtggcggcgaccactcggaactc
ggtgcggtggacgccgaggccttctgccagagccaccagttgccgctctgggacacccag
ctggtgtcctggctggtgcagaaccacctggtgatgtcgaccaccgcacaacgcaaggac
ctctccgacccgcaggtgatcttcgatttcgcccaactggtcggcgaccagacccacctc
gactacctgtacgtgctcaccgtggccgacatcaacgccaccaacccgacgctctggaac
tcctggcgcgccagcctgctgcggcagctctacaccgagaccaagcgcgccctgcgccgc
ggcctggagaacccggtggaccgcgaggagcagatccgccagacgcagaccgcggccctc
gaccaactggtgcgcaacggcatcgaccaggacgacgccgagcagctctggagtcagctc
ggcgacgactacttcctgcgccacaccgccggcgacgtggcctggcacaccgaggcgatc
ctccagcacccggacgacggcacgccgctggtgctgatcaaggaaaccacccagcgcgaa
ttcgaaagcggctcgcagatcttcatctacgccgccgaccagcacgacttcttcgcggtg
accgtggccgccatggaccagctcaacctgagcatccaggacgcccggatcatcacctcc
accagccagttcaccctcgatacctacatcgtgctggacgccgacggcgactccatcggc
aacaacccggagcgcatcgccgagatccgcgaagggctgatcgacgcgctgaagaacccc
gacgactaccccaccatcatccagcgtcgggtgccgcgccaactcaagcacttcgccttc
gccccgcaggtgaccatctccaccgacgcactgcgccaggtctcggtgctcgaggtcatc
gctcccgaccgtcccggcctgctggcgcggatcggcggcatattcctcgacttcgacctg
tcggtgcagaacgccaagatcgccaccctcggcgaacgcgtggaagacgtcttctacatc
accgacgcgcgcaaccagccgctcgccgaccccgacctgtgcaagcgcctgcaggccgcg
ctggtcgaacaactgtcacaggacaacggacgggacaccctgcccacccggataaacttc
tga

DBGET integrated database retrieval system