KEGG   Pseudomonas aeruginosa PA7: PSPA7_1553Help
Entry
PSPA7_1553        CDS       T00569                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00071  Fatty acid degradation
pap00072  Synthesis and degradation of ketone bodies
pap00280  Valine, leucine and isoleucine degradation
pap00310  Lysine degradation
pap00362  Benzoate degradation
pap00380  Tryptophan metabolism
pap00620  Pyruvate metabolism
pap00630  Glyoxylate and dicarboxylate metabolism
pap00640  Propanoate metabolism
pap00650  Butanoate metabolism
pap00900  Terpenoid backbone biosynthesis
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
pap01212  Fatty acid metabolism
pap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPA7_1553
   00630 Glyoxylate and dicarboxylate metabolism
    PSPA7_1553
   00640 Propanoate metabolism
    PSPA7_1553
   00650 Butanoate metabolism
    PSPA7_1553
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSPA7_1553
   00072 Synthesis and degradation of ketone bodies
    PSPA7_1553
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPA7_1553
   00310 Lysine degradation
    PSPA7_1553
   00380 Tryptophan metabolism
    PSPA7_1553
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPA7_1553
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPA7_1553
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSPA7_1553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pap04147]
    PSPA7_1553
Enzymes [BR:pap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPA7_1553
Exosome [BR:pap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPA7_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABR83669
UniProt: A6V1K2
Position
1577588..1578790
Genome map
AA seq 400 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALASVRPDDLAGALLARLAETCGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTINRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRALNVFDSTIGARFANPRLVERHGNDSMPETGDNVARAFGIEREEA
DRFAAGSQARYQAALASGFFAGEILPVAVRGASRDETLWVEHDEHPRPRVDLAALARLPP
LFAGGVVTAGNATGINDGAAVLLLGDRAIGEREGVAPLARILASASVGVEPRLMGIGPHL
AILRALQRAGIGLDEVGLIEINEAFAPQVLACLKLLGLDYDDPRVNPHGGAIALGHPLGA
SGARLALTAARGLQRLERRYAVVSLCVGVGQGVAMVLERC
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctatgccggcctgcgcacgcccttcggccggcacgccggggcg
ctcgcctcggtgcgtccggacgatctggccggcgcgttgctggcgcgcctggcggaaacc
tgcgggttcgccgtcgacgacctggaggatgtgatcctcggctgcaccaaccaggccggc
gaggacagccgcaacctggcgcgcaacgcgctgctcgccgccggcctgccggcgcgcctg
cccgggcagacgatcaaccggctgtgcgccagcgggctgtcggcggtgatcgacgcggct
cgcgcgatcagttgcggcgaaggccggctgtacctggccggtggtgccgaaagcatgtcc
cgcgcgcccttcgtcatgggcaaggcggaaagcgccttcagccgcgcgctgaacgtcttc
gacagcaccatcggcgcgcgtttcgccaacccccggctggtcgagcgccatggcaacgac
agcatgccggagaccggcgacaacgtggcgcgcgccttcggcatcgaacgcgaggaggcc
gaccgtttcgctgccggctcgcaggcacgctaccaggcggcgctggcatccggtttcttc
gccggggagattcttcccgtggcggtgcgcggcgcaagccgggacgagacactgtgggtc
gagcacgacgagcatccgcgcccgcgggtcgacctggccgccctggcgcgcttgccgccc
ctgttcgccggcggcgtggtcaccgccggcaacgccaccgggatcaacgatggcgcggcg
gtgctgctgctgggcgaccgcgccatcggcgaacgcgagggcgttgccccgctggcgcga
atcctcgcttccgccagcgtcggagtcgagccacggctgatgggcatcggcccgcacctg
gcgatcctccgtgcgttgcagcgcgccggcatcggcctcgacgaggtcggcctgatcgag
atcaacgaggccttcgcgccgcaggtcctggcctgcctgaagctgctcggcctggactac
gacgacccacgggtcaatccccatggcggcgccatcgccctcggccacccgctcggcgcc
tccggcgcgcgcctggcgctcaccgccgcgcgtggcctgcagcgcctggagcggcgctac
gcggtggtcagtctgtgcgtcggggtcggccagggggtggccatggtgctcgagcgttgc
tga

DBGET integrated database retrieval system