KEGG   Pseudomonas aeruginosa PA7: PSPA7_1642
Entry
PSPA7_1642        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB
Motif
Pfam: Glycos_trans_3N MukF_C
Other DBs
NCBI-ProteinID: ABR82964
UniProt: A6V1U1
Structure
PDB: 

Position
complement(1679339..1680565)
AA seq 408 aa
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVG
PPELARSLIASIAGRTTLQRYQARNALLRSLINNPLGTQTDNWIYFPTITFFDICADLAD
AAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSIALGDQFKLLNKDPATVTKYS
NPLRDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTP
QLIGAIILAEQRDQTRDEDAKDYQAAVSLKGANTSIGLGQVVVSTAIKYELFTDLLAQPV
RRGLSRKAIATLLASDEFNIFATARYIRYVANLAAQQDLRRLPKTRSAFPTIDLRAYAGN
PRNWPRDNIRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPAMRFP
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaccgccaccagcgacctgatcgagtcactgatttcctatagctgggacgactggcag
gtgacccgccaggaagcccgccgggtgatcgccgcgatccgcaacgacaacgtgcccgat
gcgaccatcgccgcactcgacaagagcggctcactgatcaagctgttccagcgggtgggc
ccgccggaactggcgcgctcgctgatcgccagcatcgccgggcgcaccaccctgcagcgc
taccaggcacgcaatgccttgctccgcagcctgatcaacaatcccctgggtacccagacc
gacaactggatctacttccccaccatcaccttcttcgacatctgcgccgacctcgccgac
gccgccggccgcctgggcttcgccgcggccggcgccaccggggtggccagccaggcgatc
cagggtccgttcagcggggtcggcgccaccggcgtcaatccgaccgacctgccgtccatc
gccctcggcgaccagttcaagctgctcaacaaggacccggcgaccgtcaccaagtacagc
aacccgctccgcgacctgggcgcctacctgagccagctgtcgccgcaagacaagctgaac
caggcacagacgctggtcggccagccgatcagcacgctgttccccgacgcctatccgggc
aacccgccgtcgcgggccaaggtcatgtccgccgccgcgcgcaagtacgacctgacaccg
caactgatcggcgcgatcatcctcgccgagcaacgcgaccagacccgcgacgaagacgcc
aaggactatcaggcggcggtcagcctcaagggcgccaacacctccatcggcctcggccag
gtggtggtctccaccgcgatcaagtacgagctgttcaccgacctgctcgcccagccggtg
cgccgcggcctgtcgcgcaaggcgatcgccaccctgctggcttccgacgagttcaacatc
ttcgccaccgcccgctacatccgctacgtcgccaacctggcggcgcagcaggacctgcgc
aggctgccaaagacccggagcgcgtttcccaccatcgatctgcgcgcctacgccggcaat
ccgcgcaactggccacgggacaatatccgcgcgctggcctcggaatacacttcgcggccc
tgggacgacaacctgtcgccgggctggccgatgttcgtcgacgatgcctacgccaccttc
ctcgaccccgcaatgaggttcccatga

DBGET integrated database retrieval system