KEGG   Pseudomonas aeruginosa PA7: PSPA7_2025Help
Entry
PSPA7_2025        CDS       T00569                                 

Gene name
purF
Definition
(GenBank) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00230  Purine metabolism
pap00250  Alanine, aspartate and glutamate metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01130  Biosynthesis of antibiotics
Module
pap_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSPA7_2025 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPA7_2025 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pap01002]
    PSPA7_2025 (purF)
Enzymes [BR:pap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     PSPA7_2025 (purF)
Peptidases [BR:pap01002]
 Cysteine Peptidases
  Family C44
   PSPA7_2025 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 PRTase_2
Motif
Other DBs
NCBI-ProteinID: ABR80710
UniProt: A6V2W6
Position
2063902..2065407
Genome map
AA seq 501 aa AA seqDB search
MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTCHDDKLYLRKDNGLVRDVFQQRHM
QRLIGSVGIGHVRYPTAGSSSSAEAQPFYVNSPYGITLAHNGNLTNVEQLAKEIYESDLR
HVNTNSDSEVLLNVFAHELAVRNKLQPTEEDIFAAVSGVHDRCVGGYAVVAMITGHGIVG
FRDPNAIRPIVFGQRHTENGVEYMIASESVALDVLGFTLIRDLAPGEAVYITEEGKLYTR
QCARAPKYAPCIFEHVYLARPDSIMDGISVYKARLRMGEKLADKILRERPEHDIDVVIPI
PDTSRTAALELANRLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQKLNAIELEFRGKN
VMLVDDSIVRGTTCKQIIQMAREAGAKNVYFCSAAPAVRYPNVYGIDMPSAHELIAHNRS
TEDVSKLIGADWLVYQDLPDLIDAVGGGKIKIDRFDCAVFDGEYVTGDVNEAYLNRIEQA
RNDATKAKSQAVSAIIDLYND
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcgtcggtatcgtgggcaagtcgaacgtcaatcaggcgctgtatgacgcg
ctcaccgtcctccaacatcgcggccaggacgctgccggtatcgtcacctgccatgacgat
aagctgtacctgcgcaaggacaacggcctggtccgcgacgtcttccagcagcgccacatg
cagcgcctgatcggcagcgtcggcatcggccatgtgcgctacccgaccgccggcagctcc
agttcggcggaagcgcagccgttctacgtcaactcgccctatggcatcaccctggcgcac
aacggcaacctgaccaacgtcgagcaactggccaaggaaatctacgagtccgacctgcgc
cacgtgaacaccaactccgactcggaagtgctgctcaacgtgttcgcccacgaactggcg
gtgcgcaacaagctgcagcccaccgaggaggacatcttcgccgcggtctccggcgtgcac
gaccgctgcgtcggcggttacgcggtggtggcgatgatcaccggccacggcatcgtcggt
ttccgcgaccccaacgcgatccggccgatcgtcttcggccagcgccacaccgagaatggc
gtcgaatacatgatcgcttccgagagcgtggccctggacgtgctcggcttcaccctgatc
cgcgacctggcgccgggcgaggcggtgtacatcaccgaggaaggcaagctctacacccgc
cagtgcgccagggcgccgaaatacgcgccgtgcatcttcgagcacgtctacctggcgcgt
ccggactcgatcatggacggcatctcggtgtacaaggcgcgcctgcggatgggcgagaag
ctcgccgacaagatcctccgcgagcgtcccgaacacgatatcgacgtggtcatcccgatc
ccggacaccagccgcaccgcggcgctggagctggccaaccggctcggcgtgaagttccgc
gagggcttcgtcaagaaccgctacatcggccgcaccttcatcatgcccggccaggcggcg
cggaagaaatccgtgcggcagaagctcaacgccatcgagctggaattccgtggcaagaac
gtcatgctggtggacgactcgatcgtccgcggtaccacctgcaagcagatcatccagatg
gcccgcgaggccggcgcgaagaacgtctacttctgctccgccgcgccagcggtgcgctat
cccaacgtctacggcatcgacatgccgagcgcgcacgagctgatcgcgcacaatcgcagc
accgaggacgtcagcaagctgatcggtgccgactggctggtctaccaggacctgccggac
ctgatcgacgcggtcggcggcggcaagatcaagatcgaccgcttcgactgcgccgtgttc
gacggcgaatacgtgaccggcgacgtcaacgaggcctatctgaaccggatcgaacaggcg
cgcaacgatgcgaccaaggcgaagagccaggcggtcagcgcgatcatcgacctgtacaac
gactga

DBGET integrated database retrieval system