KEGG   Pseudomonas aeruginosa PA7: PSPA7_2152
Entry
PSPA7_2152        CDS       T00569                                 

Gene name
lexA
Definition
(GenBank) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
KEGG Orthology (KO) [BR:pap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pap01002]
    PSPA7_2152 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pap03400]
    PSPA7_2152 (lexA)
Enzymes [BR:pap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     PSPA7_2152 (lexA)
Peptidases and inhibitors [BR:pap01002]
 Serine peptidases
  Family S24: LexA family
   PSPA7_2152 (lexA)
DNA repair and recombination proteins [BR:pap03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    PSPA7_2152 (lexA)
SSDB
Motif
Pfam: LexA_DNA_bind Peptidase_S24 HTH_20 MarR_2 Sigma70_r4 HTH_Crp_2
Other DBs
NCBI-ProteinID: ABR81282
UniProt: A6V389
Position
complement(2206768..2207382)
AA seq 204 aa
MQKLTPRQSEILSFIKRCLEDHGFPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTP
GASRGIRIPGFEPHAANDDEGLPVIGRVAAGAPILAEQNIEESCRINPAFFNPRADYLLR
VRGMSMKDIGILDGDLLAVHVTREARNGQVVVARLGEEVTVKRFKREGSKVWLLAENPEF
APIEVDLKEQELIIEGLSVGVIRR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcagaagctgacgccccgccaatccgagatcctctccttcatcaagcgctgcctggaa
gaccacggctttccgccgacccgcgcggaaatcgcccaggaactcggcttcaagtcgccg
aacgccgccgaggagcacctcaaggcgctggcgcgcaagggcgccatcgagatgaccccg
ggcgcttcccgtggcattcgcatccccggcttcgaaccgcacgcggcgaacgacgacgaa
ggcctgccggtgatcggccgggtcgccgccggcgcaccgattctcgccgaacagaacatc
gaggaatcctgccggatcaatcccgccttcttcaatcctcgcgccgactacctgttgcgc
gtgcgcggcatgagcatgaaggacatcggcatcctcgacggcgacctgctggccgtccac
gtcacccgcgaagcgcgcaatggccaggtggtggtcgcgcggctcggcgaggaggtcacg
gtgaaacgcttcaagcgcgaaggcagcaaggtctggctgctggcggaaaaccccgagttc
gctccgatcgaagtcgatctgaaggagcaggaactgatcatcgaaggcttgagcgtcggc
gtgatccggcgctga

DBGET integrated database retrieval system