KEGG   Pseudomonas aeruginosa PA7: PSPA7_2221Help
Entry
PSPA7_2221        CDS       T00569                                 

Definition
(GenBank) probable magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00860  Porphyrin and chlorophyll metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPA7_2221
Enzymes [BR:pap01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PSPA7_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA AAA_33 AAA_16 AAA_22 AAA_3
Motif
Other DBs
NCBI-ProteinID: ABR83959
UniProt: A6V3F8
Position
2276280..2277290
Genome map
AA seq 336 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPEGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLARADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLDVRLDSQPRPAERAE
IIRRRLAFDADPQAFVARWASEQEALRRRCAEARRRLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALSHRRRQQSPPTSAANPPPAAPPA
SGAAGTAGGEGQWGELPAQPVAMGVARELPRWAKKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattatcccttgtccgccgtggtcgccgccgacgagctgaagctg
gcgctatgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccttggcgcggggcgtcgccgagctgctgccggagggggagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagtctcgatctggacgcc
gctctcggcgagggccgcgcgcggttttccccgggcgtgctggccagggccgacggcggc
gtgctctacgtcgacgaagtgaacctgctgccggaccacctggtggacctgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgacggcatctcccaccggcatccggcg
cgcttcgtgctgatcggcacgatgaacccggaggagggtgagttgcgtccgcaactgctg
gaccgtttcggcctcgatgtacgcctcgacagccagccgcggccggccgagcgcgccgag
atcatccgtcgccggctggccttcgacgccgatccgcaggccttcgtcgcgcgctgggcc
agcgaacaggaggcactgcgccgccgttgcgccgaggcgcgccggcggctggcgcggatt
cccttggacgacgcggcgctggacagcatcgcccggcgctgcttcgaggcggcggtcgac
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagaggatcgaggcggaggacatcgacgcggtggaacatttcgccctgtcgcatcgt
cgccgccagcagtcaccgccgacctcggcggcgaatccaccgcccgcggcgccccccgcc
agcggagcggcgggtaccgccggtggcgaaggccagtggggcgagctgccggcgcagccg
gtggccatgggcgttgcccgcgagctgccgcgctgggcaaaaaagccctga

DBGET integrated database retrieval system