KEGG   Pseudomonas aeruginosa PA7: PSPA7_2900Help
Entry
PSPA7_2900        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_2900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_2900
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABR83495
UniProt: A6V5C5
Position
2982301..2983059
Genome map
AA seq 252 aa AA seqDB search
MPEGSAGPFSQAYLEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRR
LWRSAFASVGDAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGE
YLPLAIKRLLDERAPASRDLANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQRE
ADAADLGRRLEQPAAAPPRRLPVRAALPDGFRLGLAVLGLVLLMSGIGHLFWRDIQHEMA
AVTHLADPEQAP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagggagtgcagggcctttttcccaggcgtacctggagcagccgctcagcacg
gcattccgccaggcctggcaggaatggctggaggcctggggcgccctcgaccgcgacgcc
caggatgtgccacggatggtcgaacgcgccctcgaactgtccacccgcatcacccggcgt
ctgtggcgcagcgccttcgccagcgtcggcgacgcggcgggcgtgcaggtcaaggcgatg
gtctatgccttcgtcgccctggtcgacgagaccctggtcttcagcgcctggccggggcag
ggcgcctggcaggacaaaccgctggagtcgcatctctacggcagtcgtcaggcgggcgaa
tacctgccgctggcgatcaagcgcctgctcgacgaacgcgccccggccagtcgcgacctg
gccaacgtctacctgcaatgcctgatcctcggcttccgcggtcgcctgcgcgggccgcgc
ggcgaggcgctgcacgagaagtggcggcaggcgctgttcgccttcgcctggcagcgcgag
gcggacgccgccgacctcggccgtcgcctcgagcagcctgccgctgcgccgccacgacgc
ctgccggtgcgcgcggcgctgccggacggcttccgcctgggcctggcggtgctcgggctg
gtgctgctgatgagcggtatcggacacctgttctggcgcgacatccagcacgaaatggcg
gcggtgactcacctggccgatccggagcaggcgccatga

DBGET integrated database retrieval system