KEGG   Pseudomonas aeruginosa PA7: PSPA7_3568Help
Entry
PSPA7_3568        CDS       T00569                                 

Definition
(GenBank) probable 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00071  Fatty acid degradation
pap00280  Valine, leucine and isoleucine degradation
pap00281  Geraniol degradation
pap00310  Lysine degradation
pap00362  Benzoate degradation
pap00380  Tryptophan metabolism
pap00410  beta-Alanine metabolism
pap00640  Propanoate metabolism
pap00650  Butanoate metabolism
pap00903  Limonene and pinene degradation
pap00930  Caprolactam degradation
pap01040  Biosynthesis of unsaturated fatty acids
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
pap01212  Fatty acid metabolism
Module
pap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPA7_3568
   00650 Butanoate metabolism
    PSPA7_3568
  Lipid metabolism
   00071 Fatty acid degradation
    PSPA7_3568
   01040 Biosynthesis of unsaturated fatty acids
    PSPA7_3568
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPA7_3568
   00310 Lysine degradation
    PSPA7_3568
   00380 Tryptophan metabolism
    PSPA7_3568
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPA7_3568
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPA7_3568
   00281 Geraniol degradation
    PSPA7_3568
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPA7_3568
   00930 Caprolactam degradation
    PSPA7_3568
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSPA7_3568
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPA7_3568
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSPA7_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABR82630
UniProt: A6V787
Position
complement(3693739..3695883)
Genome map
AA seq 714 aa AA seqDB search
MTDAIRYEKGQDNIVILTMDMPGQSANTMNGAYREAMEKTVARLEAEKDGIAGVVLTSAK
KTFFAGGDLNELIKVTRADAPAFYAGILAIKGQLRRLETLGKPVVAAINGAALGGGWEIC
LACHHRIALDNPGVQLGLPEVTLGLLPGGGGVVRMVRLLGLEKALPYLAEGKKVRPAEAL
KAGLLHELAGSPEEMLEKARAWILANPAVKQPWDGAGYKIPGGTPSSPGVAQMLAIAPSV
LRDKTKGCFPAPEKIMCAAVEGAQVDFDTAQLIEARYFTELTTGQVAKNMIGTFWFQLNE
INAGKSRPQGYPVRATKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSLEAAEKGKAHSA
RLLDKKVSRGHLSAEKRDAFLARITPSASEADFEGCDLIIEAVFEDRELKAKVTAEAEKH
ALADALVASNTSTLPITGLAQAVARPEKFIGLHFFSPVDKMPLVEIIRGEKTSDKTLARG
FDYVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGISAAMIDNQARQAGMPVGPL
AISDEVSLSLMTHIRNQTARDLQAEGKALPAHPAFAVIDLMVNEYKRPGKAAGAGFYDYP
ANGRKHLWAELKSRFEKPDAQISAGDVRDRLLFIQAIETVRCVEEGVLQSTADANIGSIF
GIGFAAWSGGALQFINQYGLKDFIARAQYLAEQYGERFEPPALLLEKAAKGELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcgatccgttacgagaaaggccaggacaacatcgtcatcctgaccatggac
atgcccgggcagagtgccaacaccatgaacggcgcctaccgcgaggcgatggagaagacc
gttgcgcggctggaggcggaaaaggatggcatcgccggggtggtgctgacctcggcgaag
aagaccttcttcgccggcggcgacctcaacgagctgatcaaggtgaccagggccgacgcc
ccggccttctatgccggcatcctcgcgatcaagggccagctacggcgcctggaaaccctc
ggcaagcccgtggtcgcggcgatcaacggggcggcgctgggggggggctgggagatctgc
ctggcctgccaccatcgcatcgccctggacaatcccggcgtgcagttgggcctgccggag
gtgaccctgggcctgttgccgggcggcggcggggtggtgcgcatggtacgcctgctgggc
ctggaaaaagccctgccgtacctggccgaaggcaagaaggtgcgcccggccgaagcgctc
aaggccgggctgctccatgagctggccggcagtcccgaggagatgctggagaaggcgcgc
gcctggatcctcgccaaccccgcggtcaagcagccgtgggacggcgccggctacaagatt
cccggcggcacgccgtccagccccggcgtggcgcagatgctggccatcgcaccgtcggtg
ttgcgcgacaagaccaaggggtgcttcccggcgccggagaagatcatgtgcgcggccgtg
gagggcgcccaggtcgacttcgataccgcgcaactgatcgaggcgcgctatttcaccgag
ttgaccaccggccaggtggcgaagaacatgatcggcaccttctggttccagctcaacgag
atcaatgccggcaagtcgcggccgcagggatatccggtgcgggcgacgaagaaggtcggg
gtgctcggcgccgggatgatgggcgcgggcatcgcctacgtctcggcggcggccggcatc
gaggtggtgctcaaggacgtctcgctggaagcggcggagaagggcaaggcccattcggcc
aggttgctggacaagaaggtttcgcgcggccacctgtccgccgagaagcgcgacgcattc
ctcgcgcggatcacgcctagcgccagcgaagccgatttcgagggttgcgacctgatcatc
gaggcggtcttcgaggaccgcgaactcaaggccaaggtcaccgccgaggcggagaaacat
gccctggccgatgcgctggtggcgtccaacacctcgaccctgccgatcaccgggttggcg
caggcggtggcgcggccggagaagttcatcggcctgcatttcttcagcccggtggacaag
atgccgctggtggagatcatccgcggcgagaagaccagtgacaagaccctggcacgcggc
ttcgactacgtgctgcagatcaagaaaacgccgatcgtggtcaacgacagccgcggcttc
ttcacctcgcgggtcttcggcaccttcaccaacgaaggcatcgccatgctcggcgaaggc
atcagcgccgcgatgatcgacaaccaggcgcgccaggccgggatgccggtggggccgctg
gcgatttccgacgaagtctccctgagcctgatgacccacatccgcaaccagaccgcccgc
gacctgcaggccgagggcaaggcactgccggcgcatccggcgttcgccgtgatcgacctg
atggtcaacgagtacaagcgcccgggcaaggccgccggtgccggcttctacgactacccg
gcgaacggcaggaaacatctctgggcggaactcaagagccgtttcgagaaacccgatgcg
cagatctccgccggggacgtacgcgaccgcctgctgttcatccaggccatcgagacagtg
cgctgcgtggaggagggcgtgctgcagtccaccgcggacgccaacatcggctcgatcttc
ggcatcggcttcgccgcctggagcgggggcgccctgcagttcatcaaccagtacggcctg
aaggacttcatcgcccgtgcccagtacctggccgaacagtacggcgagcgcttcgagcca
ccggcgctgttgctggagaaggcggcgaagggcgaactgttctga

DBGET integrated database retrieval system