KEGG   Pseudomonas aeruginosa PA7: PSPA7_3613Help
Entry
PSPA7_3613        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
pap  Pseudomonas aeruginosa PA7
Brite
KEGG Orthology (KO) [BR:pap00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_3613
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 Glyco_H_20C_C
Motif
Other DBs
NCBI-ProteinID: ABR82748
UniProt: A6V7D2
Position
complement(3742501..3742908)
Genome map
AA seq 135 aa AA seqDB search
MTGYGSLFERLTGETDKRAGWSSEVSAMASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDM
RLSLHDALSQARAAIESFIEAYEPRLGEVHVVPLPPDNDQLRLAFSIEGLLEVEGVKRQV
SFSACLDGRGQVTVS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacggcagtctgttcgaacgcctcaccggcgagacggataaacgcgctggc
tggagcagcgaggtttccgccatggcgtcggtggctgcccatctggccaagatgctcagc
acccgggcgggcagcgtgcagacgctgtccgactacgggttacccgatctcaacgacatg
cgcctgagcctgcatgatgccctgagccaggcccgggcggccatcgaaagcttcatcgag
gcctatgaaccacgcctgggcgaggtgcatgtcgttcccctgccgccggacaacgaccaa
ctccgcctggccttcagcatagagggcctgctggaagtggagggagtcaagcgccaggtg
agtttttccgcgtgcctggatgggcgcggccaggtgacggtcagttga

DBGET integrated database retrieval system