KEGG   Pseudomonas aeruginosa PA7: PSPA7_3686Help
Entry
PSPA7_3686        CDS       T00569                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00020  Citrate cycle (TCA cycle)
pap00640  Propanoate metabolism
pap00660  C5-Branched dibasic acid metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
Module
pap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPA7_3686 (sucC)
   00640 Propanoate metabolism
    PSPA7_3686 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSPA7_3686 (sucC)
Enzymes [BR:pap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSPA7_3686 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABR82285
UniProt: A6V7K5
Position
complement(3817261..3818427)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACDKIGGGEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAQQWLGKNLVTYQTDANGQPVSKILVESCTDIDKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPYQGRELAFQLGLKGDQIKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNALYRQPKLRAMHDPSQDDA
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggctttgccgtagacacccccgaagaggccgcagaagcctgcgacaagatcggcggc
ggcgagtgggtcgtcaaagctcaggtgcacgccggtggccgcggtaaagcgggcggtgtg
aagctggtgaagagcaaagaggacgccaaggcgttcgcccagcagtggctgggcaagaac
ctggtgacctaccagaccgacgccaacggccagccggtcagcaagatcctggtggagtcc
tgcaccgacatcgacaaggagctgtatctcggcgccgtcgtcgatcgttccagccgccgc
atcgtgttcatggcttccaccgagggtggcgtggacatcgagaaggtcgcccacgacact
cccgagaagatcctcaaggccaccatcgacccgctggtcggcgcgcagccgtaccagggc
cgcgagctggccttccaactgggcctgaagggcgaccagatcaagcagttcacccatatc
ttcgtcggcctggcgaagctgttccaggactacgacctggccctgctggaagtgaacccg
ctggtgatcaagaaggacggcaacctgcactgcctggacgccaagatcaacatcgacagc
aacgccctgtaccgccagccgaagctgcgcgccatgcacgacccgtcccaggacgacgcc
cgtgaagcccatgcgcagaagtgggagctgaactacgtcgcgctggaaggcaacatcggc
tgcatggtcaacggcgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgcgaccaaggagcgcgtcaccgaa
gcgttcaagatcatcctgtccgacagcaacgtgaaggccgttctggtgaacatcttcggc
ggcatcgtgcgttgcgacatgatcgccgaaggcatcatcggcgccgtcaaagaagtcggc
gtgaaggttccggtcgtcgtccgcctggaaggcaacaacgctgaactgggtgccaaggtc
ctggccgagagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcaa
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system