KEGG   Pseudomonas aeruginosa PA7: PSPA7_3702
Entry
PSPA7_3702        CDS       T00569                                 
Symbol
trbJ
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSPA7_3702 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_3702 (trbJ)
Secretion system [BR:pap02044]
 Type IV secretion system
  Trb secretion system protein
   PSPA7_3702 (trbJ)
SSDB
Motif
Pfam: DUF4141 DUF948 DUF2749 LZ3wCH DUF2368
Other DBs
NCBI-ProteinID: ABR80937
UniProt: A6V7M1
Position
complement(3837322..3838047)
AA seq 241 aa
MKKRLVAAAIAAMLCTATAHAQWVVVDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLM
NQARNLASLPSSVVGQLRANLATTERLIAQARGLAYDLTNLDREFARLYPEQYAATVSGD
QMYRDAQERWRNTLNGLQTTMQMQAQVSQNLGEDESVLADLVGKSQSAEGALQAMQAMNQ
LLALQAKQSIQSQRLQITQDRAASLELARQAAATERAREVRRRFLGEGTPYTPQSVNFYG
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagaagcgtcttgtcgccgccgccatcgcggccatgctttgcaccgccaccgcccat
gcgcaatgggtcgtggtcgatcccacgaacctcgtgcagaacacgctgaccgcgatccgc
acgctggagcagatcaacaaccagatccagcagctccaaaacgaagcgcagatgctgatg
aaccaggcgcgcaacctcgccagcctgccgtccagcgtggtcggccagttgcgcgccaac
ctggcgacgaccgagcggctgatcgcccaggccaggggcttggcctacgacctgacgaat
ctggatcgggagttcgcgcgcctgtatcccgagcagtacgccgccaccgtcagcggcgac
cagatgtaccgcgacgcgcaggagcgttggcggaacacgctcaacggcttgcagaccacg
atgcagatgcaggcgcaggtgtcgcagaacctgggcgaagacgagagcgtgctggccgat
ctcgttggcaagagccagtcggccgaaggtgcgttgcaggcgatgcaggccatgaatcag
ttgctggccttgcaggccaagcagtcgatccagtcgcagcggctccagatcacgcaagac
cgggcggcgtcgctggaactggcgcggcaggcggcagccacggagcgcgcccgcgaagtg
cggcggcgtttcctgggcgaaggcacgccgtacacgccgcagtccgtgaacttctacggc
aactga

DBGET integrated database retrieval system