KEGG   Pseudomonas aeruginosa PA7: PSPA7_3703
Entry
PSPA7_3703        CDS       T00569                                 
Name
(GenBank) ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSPA7_3703
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_3703
Enzymes [BR:pap01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PSPA7_3703
Secretion system [BR:pap02044]
 Type IV secretion system
  Trb secretion system protein
   PSPA7_3703
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 AAA_22 TraG-D_C CbiA AAA_16 NACHT TrwB_AAD_bind FtsK_SpoIIIE ABC_tran DUF87 RsgA_GTPase
Other DBs
NCBI-ProteinID: ABR85673
UniProt: A6V7M2
Position
complement(3838044..3840497)
AA seq 817 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTAQFRGPDLDSATQGELIATSA
RLNNALRRMGSGWALFIEAERRPAADYPHSEFPEPLSWVVEEERRAAFEESGNHFESGYH
LTLLYLPPEESRARAARMLYENTPTNGVDWRERLQAFVAEADRVFDLLDGVMPEIDWLDD
AQTLTYLHAAISTRRYRVGVPEVPFHIDALLTDSALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELSRLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDEDAAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRVFAFDMGR
SMRAAILGLGGEHYGLGTDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPDEKA
AIWSALGSLAGAPVEQRTMTGLSVLLQSNTLRQALSPYVLGGAHGKQLDADHDRLGMADV
QCFEMEELMHSKAAVMAVLHYLFARFDERFDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPNPQANEPQIRTIYEGFGLNRR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIDRVLLDAGVPGF
AGAWLRHRGLDWAADLLPSFPGLAPGSLADQPLENLS
NT seq 2454 nt   +upstreamnt  +downstreamnt
atgctgaatctcgccgaataccgccagcgcccggccttgcttgccgactggctgccctgg
gccgggctggtcgcaccgggcgtcgtcttgaacaaggacggcagtttccagcgcacggcc
cagtttcgcgggcctgacctcgacagcgcgacgcaaggcgaactgatcgccacgtcggcg
cggttgaacaacgcgctgcgccgcatgggatcgggctgggcgctattcatcgaagccgag
cgccggcctgcggccgattatccgcactcggagtttcccgagccgctttcgtgggtggtg
gaggaagaacgccgggccgccttcgaggaatcgggcaatcacttcgagagcggctatcac
ctgacgctgctttacctgccgccggaagaatcccgcgcccgtgcagccaggatgctctac
gagaacacgccgacgaatggcgtggactggcgcgagcggctgcaagccttcgtcgcggaa
gcggatcgcgtctttgacctgctcgacggcgtgatgccggaaattgactggctcgatgac
gcgcagacgctgacctacctgcacgccgccatttcgacgcggcgctaccgcgtcggcgtg
cccgaagtgccgttccacatcgacgcgctcctgaccgattccgcgctggtcggcggcttg
gcacccatgctgggcgaccagcacctgcgcgtggtgtcagtgcggggcttcccaacctcg
acctggccggggattctggacgacctcaaccgcctcggttttgcgtaccgctggagcacg
cgctttctctgcctcgacaaagccgaggcggaaaaagagctttcccgcctgcgccgccag
tggttcgccaagcgcaagaacgtcatcgcgctgctgcgcgaaacgatcttccagcaggaa
agcccgctggtcgataccgacgccaacaacaaggccgccgatgccgacgctgccttgcag
gagctgggcagcgatcaagtcgccttcggctatctgacggcgaccgtcaccgtcatggac
gaggacgccgccgtcgcagacgagaagctgcgcatggtggagcgcgtcatccagggccgg
ggcttcgtcaccatccctgaaacgctcaatgccgtggatgcctggttgtcctcgctcccc
ggcaacgcctacgccaacgtgcgccagcccatcgtctcgacactgaacttggcgcacatg
atgccggtgtcggcggtatgggctgggccggagaagaacgaccacctcgacggcccgccg
ctgatcgtcacgcgcaccgatggcgccacgccgttccggctggtgacgcacatcggcgat
gtgggccacacgctggtcgcggggccgactggcatgggcaagtcggtcttgctcgccacg
ctggcgatgcaatttcgccgctatcgcggctcgcgcgtcttcgccttcgacatgggccgc
tccatgcgggccgccatcctcggcctgggcggcgaacactacggcctgggcacggatggc
gaaatcgccttccagccactcgcgcgcatcgaccgtgagggctaccgcacctgggccgcc
gaatggatcgaaggccgcttgctgcacgagggcgtggcggtcggccccgacgagaaagcg
gctatctggtcggcgctgggaagtctcgccggtgcgccggtggagcagcgcacgatgacg
ggactttccgtgctgctgcaatcgaacacgctgcggcaggcgctgtcgccctatgtgctg
ggtggcgcccacggcaagcagctggacgccgaccacgaccggctgggcatggccgacgtg
cagtgcttcgagatggaggagctgatgcacagcaaggccgccgtcatggccgtgctgcat
tacctctttgcgcgtttcgatgaacgcttcgacggagcgcccacgctgctgatcctcgat
gaagcgtggctgttcctcgatgacccggtgtttgccgcgcgtatccgccagtggctcaag
acactgcgcaagaagaacgtcagcgtcatcttcgccacgcagagccttgccgacatcaag
gattcgagcatcgcgcccgcgatcatcgagagctgcgcgagtcggattttcttgcccaac
ccgcaggcgaacgagccgcagattcgcacgatctacgagggcttcggcctcaacaggcgg
cagatcgaaatcgtcgccaccgcgcagcccaagcgcgactactactaccaatcccgcctc
ggcaaccgcctgttcgacctcgacctggggccggcggcgctggcgtttgcgggcgcttcc
acgccgcaagaccagcgcgacatagaccgcgtgctgctggacgccggcgtgcccggcttc
gcgggcgcctggctgcgccatcgcggcctcgattgggcggccgacctgctgccctcgttc
cccggcctcgcgccgggttccctcgctgaccaacccctggagaacctgtcatga

DBGET integrated database retrieval system