KEGG   Pseudomonas aeruginosa PA7: PSPA7_3705
Entry
PSPA7_3705        CDS       T00569                                 
Name
(GenBank) conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSPA7_3705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_3705
Secretion system [BR:pap02044]
 Type IV secretion system
  Trb secretion system protein
   PSPA7_3705
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: ABR84565
UniProt: A6V7M4
Position
complement(3840782..3841165)
AA seq 127 aa
MTQMTIPAFRFSANPALRLARLRCLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQ
SILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFS
FSGGAVV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgacgcagatgaccattcctgctttccgtttttctgcaaatccggctttgcgtcttgcg
cggctgcgttgcctggcccgtcctgcggggcaagggctgctgctggccgcgctgctgttg
ttcctggccggaaccgcgcaggccgcaggttcctcgatgccgtgggaaggcccgctgcaa
tccatcctcgaatccatccaggggccggtggcgcgcatcgtcgcggtcatcatcatcatt
gccacgggcctcgcgctcgcgttcggcgacacgtccggcgggttccgcaaactgatccag
atcgtcttcggtctgtccatcgccttcgcggcttccagcttcttcctgtcgttcttcagc
ttctccggcggggccgtcgtatga

DBGET integrated database retrieval system