KEGG   Pseudomonas aeruginosa PA7: PSPA7_3959Help
Entry
PSPA7_3959        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat RHS
Motif
Other DBs
NCBI-ProteinID: ABR82496
UniProt: A6V8C8
Position
complement(4099703..4103662)
Genome map
AA seq 1319 aa AA seqDB search
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGCKLLPE
EVDFALAAPDTFTFARGYLSSNPRVGRLGQGWWLPGESMHLELGDEACVLVDAQGRRIAF
PALAPGAQFYSGSEELWLRRGGSNREDGEVEAWRGRWAAVPAELRAQEASVLVLSGHSYL
HFLRHPDGIWRLQASFGRAGYRTEYRWSGRGLLTGVRDSAGRSYALVYQQACAPSEGDDG
LRLFGVILASHDGPAPDHIDPQDPGLDWLVRYQFNDSGDLIAVRDRLGQVVRVFAWHAHM
LVAHGEPGGLEVRYEWDVHAPHGRVLKQIEAGGLTRSFRYLRDATEVSDSLGRVERYEFA
GEGGQRRWTALVRADGSRTEFDYDLFGRLVALRDPLGRETRRRRDGQGRTLEEETPGKAR
YRKTLDEETGLLVELEDAMQRRWRFERDERGNPVTVHGPAGSTRYRYEDARLPDRPTRIV
DPRGGERRLEWNRLGLLAALTDCSGQTWRYEYDSEGRLTCETDPLGQVTRRRYDPLGQLI
GLALADGSALGYAYDALGRQTRISDAEGRATLFSWGHGDLLALVSDASGRELSYQHDEAG
RLLTLTNENGAQAHFRYDPLDRLVEETGFDGRRQRYRYNAADELVAREDADGRETAYAYD
RDGRLASVRIPASDAAPALVERYRWLADGRLASAVGPDCEVRYEYDEVGNLRLESQLHAD
GWVYSVEHSHDELGMRQTSRYGDAPPVTWLTYGAGHLHGALVGAIELAFERDALQREVRR
DARHGGKSDALFVQERRYGALGRLQESRLRLAGGADWQRGYRYDGLGQLVGIDDNQQPAV
RYEYDLAGRLLGSRRAGLPDRRYHYDAAGNRLDDEVANRREAGRQAFEHNELYRSGFTRS
ASGESETGEAPQRWLGNRVQRIAGNRYHFDAQGNLVERVGADGERLRLAYDGAQRLVRLT
REAADGTRVEARYRYDALSRRIAKSVLRDGVEQQVRFGWDGDRQCAEAFERQLRTTVHEP
GGFVPLLRLEQAREPDTPELLELRRTFAAEGQPLPAQCVPELGEARFAFFHTDHLGTPLQ
LSDERGQLRWQGVAHDWRAVEPDREPGAQPIRFQGQYHDEESGLYYNRYRYYLPEAGRYA
SQDPLGLGGGPNPYTYALNAPSVAYDPTGLIIPLVVIGAFAARAAIGAALGAGIELGMQT
GKQVLGQMKDNWDNDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSARAI
RTLSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctacccgtttcccatgtcggtgaaaaagtctcgggaggcgtgatctccacc
ggctctcccaccgtgcacgtcggcagcagcgcggtcggcctggccgaccgggtgtcggcc
tgcgtgccgctggtgggcaaaccggtcaacccgatgctcgggtgcaagttgttgccggag
gaggtcgatttcgccctggcggcgccggacaccttcaccttcgcccgcggctacctgtcg
agcaatccgcgggtcgggcggctcggccagggctggtggctgccgggcgaaagcatgcat
ctggaactgggtgacgaggcttgcgtgctggtcgatgcccaggggcggcggatcgctttt
cccgccctggcgccgggcgcgcagttctattccggcagcgaggagctctggctgcgccgc
ggcggctcgaaccgcgaggacggcgaggtggaggcctggcgcggacgctgggcggcggtg
ccggccgaactccgggcgcaggaagcctcggtgctggtgctctcgggccacagctacctg
cacttccttcgccatcccgacggtatctggcgcctgcaggccagcttcggccgcgccggc
taccgtaccgagtaccgctggagcggacgcggtctgctcaccggcgtgcgcgacagcgcc
ggacgcagctatgcgctggtctaccagcaggcctgcgcgccgagcgagggcgacgacggc
ctgcgcctgttcggcgtgatcctggccagccacgacggcccggcgccggaccatatcgac
ccgcaggatcccgggctcgactggctggtgcgctaccagttcaacgacagcggcgacctg
atcgccgtgcgcgatcgccttggccaggtggtgcgggtgttcgcctggcacgcgcacatg
ctggtcgcccatggtgagccgggcgggctggaggttcgctacgagtgggatgtccatgcc
ccgcacgggcgggtgctgaaacagatcgaggcgggcggcctgacccgcagcttccgctac
ctgcgcgatgccaccgaggtcagcgacagcctcggccgcgtcgaacgctacgagttcgcc
ggcgaaggcgggcagcggcgctggacggcgctggtcagggctgacggcagccgcaccgag
ttcgactacgacctgttcggccgcctggtcgccctgcgcgacccgctgggccgggagacc
cggcgccggcgcgatggccaggggcggacgttggaagaggagacgccgggcaaggcgcgt
taccgcaagacgctcgacgaggagaccgggctgctggtcgaactggaggacgcgatgcag
cgccgctggcgcttcgagcgcgacgagcggggcaacccggtcaccgtgcacggcccggcc
ggcagcacccgctatcgctacgaggacgcgcgcctgcccgaccggccgacgcggatcgtc
gatccgcgtggcggtgaacgacgcctggagtggaaccggctcggcctgctggcggcgctg
accgactgttccggccagacctggcgctacgaatacgacagtgaaggacgcctgacctgc
gagaccgatccgctgggccaggtcacccggcgccgctacgatccgctgggccagttgatc
ggcctggccctggccgatggcagcgccctcggctacgcctacgacgctctcggaaggcag
acccggatcagcgatgccgagggccgggccacgctgttttcctgggggcatggcgatctg
ctggcgctggtctccgatgccagcggtcgcgagttgtcctaccagcacgacgaggctggc
aggctgctcaccctgaccaacgagaacggcgcccaggcgcatttccgctacgacccgctc
gaccgcctggtcgaggagaccggcttcgacgggcgtcgccagcgctaccgctacaatgcc
gccgacgagctggttgcccgcgaggacgccgacggtcgggagaccgcctatgcctacgac
cgcgacggtcgcctggcgagcgtccggatcccggccagcgatgctgcgccggcgctggtc
gaacgttaccgctggctggccgacggccgcctggccagtgccgtcgggccggattgcgaa
gtccgctacgagtacgacgaggtgggcaacctgcgcctggaaagccagctacatgccgat
ggctgggtctacagcgtcgagcacagccacgacgagctgggcatgcgtcagaccagccgc
tacggcgacgcgccgccggtgacctggctgacctacggcgccggtcacctgcacggcgcg
ctggtcggcgccatcgagctggccttcgagcgtgacgccctgcagcgcgaggtgcgtcgc
gacgcgcgccatggtgggaagagcgatgcgctgttcgtccaggagcgccgctacggtgcg
ctggggcgcctgcaggagagtcgcctgcgcctggccgggggcgccgattggcaacgtggc
tatcgctacgacggactcgggcaactggtgggcatcgacgacaaccagcagccggccgtg
cgctacgaatacgaccttgccggccgcctgctcggcagccggcgagccggcctgccggac
cgccgctaccactacgacgccgccggcaaccgcctggacgacgaggtggcgaaccggcgc
gaagcgggtcgccaggccttcgagcacaacgaactgtaccgttccgggttcactcgctcc
gcaagcggcgagagcgagaccggcgaggccccgcagcgctggctcggcaaccgggtgcag
cggatcgccggcaatcgctaccacttcgatgcccagggcaacctggtggagcgcgtcggt
gccgacggcgagcgcctgcgcctggcctacgacggcgcgcagcgcctggtccggctgacg
cgcgaggctgccgacggcacgcgggtggaggcgcgctatcgctacgacgcactgtcgcgg
cggatcgccaagagcgtgctgcgcgacggcgtcgagcaacaggtgcgtttcggctgggac
ggcgaccgccagtgcgccgaggccttcgagcggcagctgcgcacgacggttcacgaaccg
ggcggtttcgtcccgctgctgcgcctggagcaggcccgcgaacccgataccccggaactg
ctcgagctgcgccggacgttcgctgccgaaggccagccgctgccggcgcaatgcgtgccg
gaactgggcgaggcgcggttcgcattcttccataccgatcatctcgggacccccctgcaa
ctcagcgacgaacgcgggcaactgcgctggcagggcgtcgcgcacgactggcgggcggtc
gagccggaccgcgagcccggcgcgcagccgatccgcttccagggccagtaccacgacgag
gaaagcggcctctactacaaccgctatcgctattacctgcccgaggccggccgctacgcc
agccaggatccgctcggcctgggcggcgggcccaatccctatacctatgcgctgaacgcg
ccgtcggtggcctacgaccccaccggcctgatcatcccgctggtggtgatcggcgccttc
gccgcgcgggccgcgatcggcgcggcgctgggcgccggtatcgagctgggcatgcagacc
ggcaagcaagtgctgggacagatgaaggacaactgggacaacgatcgcgatctcaccgac
atcaagtggaagtgcatcgacatcaactggaagcatgtcggcgcctcggcggcgatcggc
accgtggcgccgggcatgctcagcaccggcaagacggtggtccagtcggcgagggcgatc
aggaccctctcggggcaggcggcgaacaccgccaaccgcgcggccaagctggccgcgcgc
aaggccgcgcatgccgataccatcaagaaggcggtggccacccaggccgcctggcagacg
ggcaagcagatcgtcaagtgcccgctgaaggacgaagaagaggagtgcccaccgcaatga

DBGET integrated database retrieval system