KEGG   Pseudomonas aeruginosa PA7: PSPA7_3960
Entry
PSPA7_3960        CDS       T00569                                 

Definition
(GenBank) type VI secretion protein ImpA
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSPA7_3960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pap02044]
    PSPA7_3960
Secretion system [BR:pap02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSPA7_3960
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: ABR83161
UniProt: A6V8C9
Position
complement(4103712..4105781)
AA seq 689 aa
MLFSQHTRLVHVDSPLGPEVLQLQRLEGREELGRLFNHELELVSSNHALPLDALLGKPMS
LALELPGGIRRHFHGIVARCSQGAGSGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDI
IKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHIL
VLSDAYGAHQSPVGYASVPYYPPTLGHRERDHFFDWHVAREVQPGSLSLNDYDFQRPGTR
LEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIEAIQTQHERVRLRGCARGIGS
GHLFHLSNYPRLDQNREYLVVAAEYRVVQELLETGNGGAGAQFESELDCIDAAQPFRPLP
LTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGG
TPANFNEIRMEDKKGAEQLYIHAEKNQDIEVENDETHWVGHDRSKTIDHDETVHVKHDRT
ETVDNNETITVHANRSKTVDRNETVKIGMNKSETILMASLQNVGMGRMENVGLGYSLNVG
MMMNTVVGLNQSTQVMKKKTLSVGDSYEVSVGGSDDGSKIGLDGRSIVLGSQRIELTADR
EILLRCGQSTIRITPAEIEILSPNVDINC
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgctgttctcccaacatacccgcctggtccacgtggattcccctttgggccccgaggtc
ctgcaactgcaacggctggaaggccgcgaagagttgggcaggctgttcaaccacgagctc
gagctggtttcgagcaatcacgccctgcccctggacgccctgctgggcaagccgatgagc
ctggcactggaattgcccggcggcatccggcggcatttccacggcatcgtcgcgcgctgc
agccagggtgccggcagcggccagttcgccagctaccaggtcaccctgcggccctggctg
tggctgctcacgcgcacctccgactgtcgcatcttccagaaccagaaggtcccggacatc
atcaagcaggtgttccgcgatctcggcttctccgacttcgaggatgccctgacacgcccc
taccgcgagtgggagtactgcgtgcagtaccgcgagaccagcttcgacttcgtcagccgg
ctgatggagcaggagggcatctactactggttccgccacgagaagaagcgccacatcctg
gtcctctccgacgcctacggtgcgcaccagagcccggtcggctacgccagcgtgccttac
tacccgccgaccctcggccaccgcgagcgcgaccatttcttcgactggcacgtggcgcgc
gaggtccagcccggttcgctgagcctcaacgactacgatttccagcgtcccggcacccgc
ctggaggtgcgctccaacgtggggcgcgcccatgcggcggcggactacccgctgtacgac
taccccggggaatacgtgcagagccaggatggcgaacactacgcgcggacccgcatcgaa
gcgatccagacccagcacgagcgggtacgcctgcgcggttgcgccaggggcatcggctcc
gggcacctgttccacctgagcaactatccgcggctcgaccagaaccgcgagtacctggtg
gtggcggcggaataccgggtggtccaggagcttctcgagaccggcaatggcggcgccgga
gcgcagttcgagagcgaactggactgcatcgatgccgcccagccgttccggccgttgccg
ctgacgccggtgccggtggtgcgcggcccgcagaccgcggtggtggtcgggcccaagggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggaccgccac
gaccagtcgaacgagaacagctcctgctggatgcgcgtatcccaggcctgggccgggaag
aactggggctcgatccagatcccgcggatcggccaggaggtgatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacagtgcct
tacgaactgccggcgaacgccacccagagcggcaccaagagccgttcgagcaagggcggc
acgccggccaacttcaacgagatccgcatggaggacaagaagggcgccgagcagctgtac
atccacgcggagaagaaccaggacatcgaggtcgagaacgacgagacccactgggtcggt
cacgaccgcagcaagaccatcgaccacgacgagaccgtgcacgtgaagcacgatcgcacc
gagacggtggacaacaacgagaccatcaccgtgcatgccaaccgcagcaagacggtggac
cgcaacgaaacggtgaagatcggcatgaacaagagcgagaccatcctcatggcctcgctg
cagaacgtcggcatggggcgcatggaaaacgtcggcctcggctacagcctcaatgtcggc
atgatgatgaacacggtggtcgggttgaaccagagcacccaggtgatgaagaagaagacc
ctgtcggtgggcgacagctacgaagtgagcgtgggcggcagcgacgacgggtcgaagatc
ggcctggacggcaggagcatcgtcctcggcagccagcgcatcgagctgaccgccgaccgc
gagatcctcctgcgctgcgggcagagcaccatccgcatcaccccggcggagatcgagatc
ctctcgccgaacgtcgatatcaactgttga

DBGET integrated database retrieval system