KEGG   Pseudomonas aeruginosa PA7: PSPA7_3980Help
Entry
PSPA7_3980        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHR-2 Chrome_Resist
Motif
Other DBs
NCBI-ProteinID: ABR85268
UniProt: A6V8E9
Position
4123960..4124193
Genome map
AA seq 77 aa AA seqDB search
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEEALA
QYSGLPPYDRLVDDPAA
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaaaccccagaccctgatggtggcgatccagtgcgtcgccgcgcgcacccgc
gaactcgacgcgcagttgcagaacgacgacccgcagaacgccgctgaactcgaacagctg
ctggtcggctacgacctcgccgccgacgacctgaagaacgcctacgaagaggccttggcg
caatacagcggcctgcctccctatgaccggctggtcgacgacccggccgcctga

DBGET integrated database retrieval system