KEGG   Pseudomonas aeruginosa PA7: PSPA7_4113Help
Entry
PSPA7_4113        CDS       T00569                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00860  Porphyrin and chlorophyll metabolism
pap01100  Metabolic pathways
Module
pap_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPA7_4113 (cobQ)
Enzymes [BR:pap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PSPA7_4113 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: ABR81534
UniProt: A6V8T2
Position
complement(4246624..4248096)
Genome map
AA seq 490 aa AA seqDB search
MSDRGRTLMVQGTTSDAGKSTLVTALCRWLARRGVAVAPFKPQNMALNSAVTADGGEIGR
AQAVQAQACRLAPHTDMNPVLLKPNTDIGAQVIIHGRAVTSMDAAAYHDYKRVAMEAVLA
SHARLAAAYRVVMVEGAGSPAEINLRANDIANMGFAEAVDCPVILVADIDRGGVFAHLVG
TLELLSDSERERVRGFVINRFRGDIALLQPGLDWLEARTGKPVLGVLPYVSDLHLEAEDA
IDTRQAAKTGPRLKVVVPVLPRISNHTDFDPLRLHPQVELSFVGPGQALPPADLIVLPGS
KSVRADLAALRERGWDEAILRHLRYGGRLLGICGGLQMLGERLHDPLGLEGAAGSSAGLG
LLALETTLEADKQLRNVQGRLSLEDAPLSGYEIHAGVTRGEALARPAVVLDDGRADGARS
VDGNVMGTYLHGLFESTAACSALLRWAGLREVRAVDYQALRERDIERLADLVERHLDTGR
LLALCGEPHA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgcggacggaccctgatggtccagggcaccacctcggacgccggcaagagc
accctggtgaccgcgctgtgccgctggctggcccggcgcggcgtcgcggtggcgccgttc
aagccgcagaacatggcgctgaacagcgcggtcaccgccgacggcggcgagatcggccgc
gcccaggcggtgcaggcccaggcctgccggctggcgccgcacaccgacatgaacccggtg
ttgctcaagccgaacaccgacatcggcgcacaggtgatcatccatggccgcgcggtgacc
agcatggacgccgccgcctaccacgactacaagcgcgtggcgatggaagcggtgctggcc
tcccatgcgcgtctcgccgccgcctaccgggtggtgatggtggagggtgccggctcgccg
gcggagatcaacctgcgcgccaacgacatcgccaacatgggcttcgccgaagcggtggat
tgcccggtgatcctggtcgccgatatcgaccgcggcggggtcttcgcccacctggtcggc
accctggaactgctctccgactcggagcgggagcgggtcaggggcttcgtcatcaatcgc
ttccgcggcgacatcgccctgctgcaacccggcctcgactggctggaggcgcgcaccggc
aagccggtgctcggcgtgctgccctatgtcagcgacctgcacctggaggcggaggacgcc
atcgatacgcgccaggcggccaagaccgggccgcgcctgaaggtggtggtgccggtgctg
ccgaggatcagcaaccacaccgatttcgatccgctgcgcctgcacccccaggtcgagttg
agcttcgtcggccccggccaggcgctgccgccggcggacctgatcgttttgcccggctcg
aagagcgtgcgcgccgacctcgcggcgctgcgcgagcgcggctgggacgaggcgatcctc
cgccacctgcgctacggcggtcgcctgctggggatctgcggcggcctgcagatgctcggc
gagcgcctgcacgatccgctcggcctggaaggcgcggccggcagcagcgctggcctcggc
ctgctggcgctggaaacgaccctggaagcggacaagcaactgcgcaacgtacagggccgc
ctgagcctggaggacgcgccgctgtcgggctacgagatccatgccggggtcacccgtggc
gaggccctggcgcggccggcggtggtgctcgacgatggccgcgcggatggtgcccgcagc
gtcgacgggaacgtcatgggcacctacctgcacggcctgttcgaatccaccgcggcctgt
tcggcgctgctgcgctgggccggcctgcgcgaggtccgggcggtggactaccaggccttg
cgcgaacgcgacatcgagcggctcgccgacctggtcgagcgccacctggataccgggcga
ttgctcgccctctgcggagaaccccatgcgtga

DBGET integrated database retrieval system