KEGG   Pseudomonas aeruginosa PA7: PSPA7_4497Help
Entry
PSPA7_4497        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABR86054
UniProt: A6V9W2
Position
4627042..4627794
Genome map
AA seq 250 aa AA seqDB search
MNRTVSLLSGLVLLSYPAVGQEAAASRETSSQLSGSQLGTLKQQTSQSDLAQEWGLNQQE
WTRYQTLMQGPRGVYSPGIDPLTALGIEARSAEERRRYADLQVQAERRRVEKELAYQRAY
DEAFARAYPGEGVIRLTESSTANPSGTPNMSPALQSSGRLALFVQDNCTACIQRVRDLQQ
QNKEFDLYFVGSQNDAERVRHWAILAGVDPKKVRSKQITLNHDEGRWMALGLGGALPALV
QEVNGRWQRL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaccgtatcgctcctgtccggcctggtgctgctgagttatcccgcagtcggt
caggaggctgcggcaagccgagagaccagcagccagctgtccggtagccaactcggcacg
ctgaaacagcagacatctcagagcgacctggcccaggagtggggactgaaccaacaggaa
tggacccgctaccagacgctcatgcaaggccccaggggcgtgtactcgcctggcattgac
ccgctgactgcgctgggcatcgaggcgcgatcggcagaggaacggcggcggtatgccgat
ctacaggtccaggccgaacggcgccgggtcgagaaggaactcgcctaccagcgcgcatac
gacgaagccttcgcccgcgcctatccaggcgagggggtgatccgcctcaccgaaagcagc
acggccaacccgtcgggcaccccgaacatgagcccagcgttgcagagcagcgggcgcctg
gccctgttcgtccaggacaattgcaccgcctgcatccagcgggtccgcgacctgcagcag
cagaacaaggagttcgacctctacttcgtcggtagccagaacgacgcagagcgagtgcgg
cattgggcaatcctcgccggcgtcgacccgaagaaggttcgcagcaagcagatcacgctc
aatcatgacgagggccgctggatggccctgggactgggcggggcccttcccgccctggtc
caggaggtgaacggccgatggcaacgtctgtaa

DBGET integrated database retrieval system