KEGG   Pseudomonas aeruginosa PA7: PSPA7_4511Help
Entry
PSPA7_4511        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2895
Motif
Other DBs
NCBI-ProteinID: ABR84459
UniProt: A6V9X6
Position
4637851..4638510
Genome map
AA seq 219 aa AA seqDB search
MSFRKHTAQQQAHINTFRFITGFLCMVIVVLAYCVWEARKDLWIHIPPDLRSGSTRLWWD
IPPESVYAFGLYIFQQVQRWPKDGEVDYKGNLFRYAAYLTPSCKVFLEKDFEFRRNAGEL
RGRERTTSEIPGRGIGESDGRVIQHSINDWTVNLDMDSTEYYAGEKIKRALARYPLHVIR
ADVDPETNPFGLQWDCYSDTPQRIELEEPAAPTKREGGL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagaaaacacaccgcgcaacagcaggctcacatcaacacgttccggttcatc
accggcttcttgtgcatggtcatcgtggtgctggcctactgcgtctgggaagcccgcaag
gacctctggatccacattccgcccgacttgcgttcagggagcacccggttgtggtgggac
attccgccggagagtgtctatgcattcggcctctacatcttccagcaggtacagcgttgg
cccaaggacggcgaggtggactacaagggaaacctgttccgctacgccgcctacctcact
ccctcctgcaaagtcttcctggagaaagacttcgagtttcgtcgtaacgccggcgagctc
agggggcgcgagcgcaccacctcggaaatccccggtcggggcattggcgagagcgatggc
cgcgtgatccagcactcgatcaatgactggaccgtcaacctggacatggacagcacggag
tattacgccggcgagaagatcaagcgggcgctggcccgctacccgttgcacgtcatccgc
gccgacgtcgacccggagaccaatcccttcggcctgcagtgggactgctactccgacacg
cctcaacgtatcgaactcgaggagccggccgcccccaccaagcgggagggaggtctatga

DBGET integrated database retrieval system