KEGG   Pseudomonas aeruginosa PA7: PSPA7_4515
Entry
PSPA7_4515        CDS       T00569                                 
Name
(GenBank) conjugative transfer ATPase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE TrwB_AAD_bind P-loop_TraG AAA_22 Adeno_IVa2 AAA_16 ATPase_2 DUF87
Other DBs
NCBI-ProteinID: ABR82757
UniProt: A6V9Y0
Position
4641301..4644252
AA seq 983 aa
MELLQFFRRRAQGHDAAIQEGQNTAPQEAKVQDALREEATERYLARLAAMGIPLPNTGSK
NGATQAEASRLYDHDPSFVDLLPWAEYLPDEQVMLLEDGRSRAVFFELVPLGTEGRDPNW
MQNARDALKEALQNSFDEHETSPWIVQFYAQDEISWDNFQEQLRQYVHPRARGSAFSEMY
LALMKHHLEGISKPGGLFVDTAVSKLPWRGQQRRVRMVVYRRIRKADAQIRGQDPTAYLK
SICERIQGGLANAGIVASRMSGQDVRNWLIRWFNPHPDHLGKTDADLRRFYELVCRPDEP
ILQDELPLADGTDFSQNLFYRQPVSDATQGVWLFDAMPHRVIVVDQLNKAPLTGHFTGET
LKGDGLNALFDRMPEDTLLCITMVVTPQDMLEGHLQQLSKKAVGDTQASIHTREDVATVR
RLIGREHKLYRGSIALFVRGRDHTQLEERCITLSNVLLGAGLVPVEPQNEVGPLNSYLRW
LPCNFDPNEKRALEWYTQMMFAQHIANLSPIWGRTTGTGHPGFTLFNRGGAPLTFDPFNK
LDRQMNAHGFIFGPTGSGKSASLTNLISQMLAMYLPRMFVAEAGNSFGLLADFAKRFGLS
VHRVRLAPGSGVSLAPYADAIKLVESPDQVKVLDAEDIEASDSVQGSKADLEDDQRDILG
EMEIVARLMITGGEEKEDARLTRADRSAIRQAILAAARTCAAANRTVLTQDVRDALYQAS
RSDGSAPERRARLAEMAEAMQMFCMGADGEMFNREGTPWPEADLTVVDFATYAREGYAAQ
LGIAYISLLNTVNNIAERDQFKGRPIVKITDEGHIITKHPLLLPYAMKITKMWRKLGAWF
WLATQNIDDIPASGAPMLNMIEWWLCLNMPPDEVEKISRFRELSPAQKSMMLSARKESGK
FTEGVLLAKGKEYLFRVVPPSLYLALAMTENEEKNQRYNIMQATGCDELEAALQVAADLD
KARGLPPFPIIFPDQPAVECQDE
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggaattgcttcaattttttcgccgccgcgcccaaggacatgacgcggctattcaggaa
gggcagaacaccgctccacaagaagccaaagtccaagacgcactacgggaagaagccacc
gagcgctatctggcgcgactggccgccatgggtattcctctgcccaacaccgggagcaag
aatggcgccacgcaggctgaagcgtcacgcctctacgatcacgacccatcgttcgtcgac
ctgctgccctgggctgagtacctgcccgacgaacaggtgatgctcctggaagatgggcgt
tcgcgtgccgtcttcttcgagctggtgcccttgggcaccgagggccgcgaccccaattgg
atgcagaacgcccgggacgcattgaaagaagccctgcagaactccttcgacgagcacgaa
acctcgccctggatcgtccagttctacgcccaggacgagatcagctgggacaatttccag
gagcagttgaggcagtacgtccatcctcgagcgcgaggatcggccttcagcgagatgtac
ctggcgctcatgaagcatcacctggagggcatttcgaagccgggcggactgttcgtcgac
accgccgtcagcaagctgccctggcgaggacaacagcggcgcgtgcggatggtcgtctac
cgccggatccgcaaggcggatgcgcagattcgcggacaggacccgacggcatatctgaaa
tccatctgcgagcgtatccaaggcggcctggcgaacgccggcatcgtcgcttcgcgcatg
agcggccaggacgtcaggaactggttgattcgctggttcaacccgcacccggatcacctc
ggcaagaccgatgcggatctacgtcgcttctacgaactggtatgccggccggacgaaccg
atcctgcaggacgagttgccgctggccgacggcaccgacttctcccagaacctgttctat
cggcagcctgtttccgatgccacccagggcgtatggctcttcgatgccatgccgcaccgt
gtgatcgtggtcgaccagttgaacaaggcgccgctgacaggccacttcactggcgagacg
ctcaaaggcgatggcctgaacgccctgttcgatcgcatgcccgaggacacgctgctgtgt
atcaccatggtggtgacgccgcaggacatgctggaagggcatctgcagcagctctcgaaa
aaggccgttggtgacacccaggcctcgatccacacccgcgaggacgtggccaccgttcgc
cgcctgatcggccgggagcacaagctctatcgcggttcgatcgctctgttcgtgcgcggc
cgcgaccatacccagctggaggagcgctgcatcaccctgagcaacgtgctgctcggcgcc
ggccttgtgccggtcgaaccgcagaacgaagtcggaccgctgaacagctacctgcgctgg
ctgccctgcaatttcgatccgaacgagaagcgagccctggagtggtacacccagatgatg
ttcgcgcagcacatcgccaacctgtcgcccatctgggggcgcaccaccggtaccgggcac
cctggcttcacgctgttcaaccgtggcggtgcgccgttgaccttcgacccgttcaacaag
ctggaccggcagatgaatgcccacggcttcatcttcgggccaaccgggtccggcaagtca
gcgtccctgaccaacctcatcagccagatgctcgccatgtacctgccacggatgttcgtc
gcggaagcgggcaacagtttcggcctgctggccgacttcgccaagcggtttggcctctcg
gtccaccgggtccgcctcgccccgggctccggggtcagcctggcgccgtacgcggacgcc
atcaagctggtcgagagtcccgaccaggtgaaggtcctggatgccgaagacatcgaggcc
tcggactcggtccagggcagcaaggccgacctcgaggacgaccagcgagacatcctgggc
gagatggagatcgtcgcccgcctgatgatcaccggcggcgaggaaaaggaagacgcgcgc
ctgacccgtgccgatcgcagcgccatccgccaggcgattctggcggcggccaggacctgc
gccgccgcgaaccgcacggtgctgacccaggatgtgcgcgatgcgctctaccaggcctcc
aggagcgatggctccgcgccagaacgccgcgcgcgcctggccgaaatggcggaagccatg
cagatgttctgcatgggtgccgacggcgagatgttcaatcgcgaaggcacgccctggcct
gaagccgacctcaccgtggtggatttcgcgacttacgcgcgcgaaggctacgccgcccag
ctcgggatcgcctacatctcgctgctgaacaccgtgaacaacatcgccgaacgcgaccag
ttcaagggccggcccatcgtcaagatcaccgatgaggggcacatcatcaccaagcacccg
ctgctgctgccctacgccatgaagatcaccaagatgtggcggaaactgggcgcctggttc
tggctcgccacccagaacatcgacgacatcccagcctccggggcgccgatgcttaacatg
atcgagtggtggctgtgcctgaacatgccccccgacgaggtagagaagatctccaggttc
cgcgagctgtcgccggcgcagaagtcgatgatgctctcggcccgcaaggaaagcggcaaa
ttcaccgagggcgtgctcctggccaagggcaaggagtacctcttccgtgtggttcccccg
agtctctacttagccctggccatgaccgaaaacgaagaaaagaaccagcgctacaacatc
atgcaagccaccggctgcgacgagctcgaggcggccttgcaggtcgcagcggatctcgac
aaggcgcgcggcctgccacccttccccattattttcccagaccaaccggcagtggagtgc
caggacgaatga

DBGET integrated database retrieval system