KEGG   Pseudomonas aeruginosa PA7: PSPA7_4521Help
Entry
PSPA7_4521        CDS       T00569                                 

Definition
(GenBank) putative integral membrane protein
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Borrelia_P83
Motif
Other DBs
NCBI-ProteinID: ABR81644
UniProt: A6V9Y6
Position
4648345..4649727
Genome map
AA seq 460 aa AA seqDB search
MRMNITSVALTCLLAAQLAQADDPINVSKTGTVLSDEVLYSIGGGSAVSMGSAGQMDSIG
VGFGWNNDLMCGNMNLSTTLENQLNGATQGFQNIMGSVIQNATGAVMSLPALIIQRANPQ
LYNLITNGILQARIDYDRSKGTCRAIAEKMADIAGEQTGWGKIAEGQALGATLASGGKDA
VSALEAVEKKGGNDGITWVGGDKAGGSGQKPIRIVNDVTRAGYNLLTSRSVNDSSSVPSA
TCNNGLVCNTWSSPQEAAAFATRVLGEQQQQTCEGCQKTVTAAGVGLTPLIQETYDKKLQ
SLQELLSKSKPLTAENLAAAGTDALPITRGVIEALRDERDQDVLARRLASDVSLMDVLSK
ALLLQRLMFAGAKEPNVAANGLATQAVDQQTSLLQQEISNLKTELELRRELASNSPMRVI
ERGQQRASGSSGVFESAPDADRLDRLQAPSAADGKTGGRP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgaacatcacctcggtcgcgctgacgtgcctgctcgcagcgcaacttgcccag
gccgacgacccgatcaatgtgtccaagaccggcacggttctcagcgacgaggtcctctac
agcattggcggcggcagtgcggtgagcatgggcagcgccggccagatggactcgatcggc
gtcggcttcggctggaacaacgaccttatgtgcggaaacatgaacctgagcaccaccctg
gagaaccagctcaacggtgccacacagggtttccagaacatcatgggctcagtcatccag
aacgcgaccggcgcagtcatgtcgctgccggcgttgatcatccagcgcgcgaaccctcag
ctctacaacctgatcaccaatggcatcctgcaggcgcggatcgactacgaccgctcgaaa
gggacttgcagagcgatcgccgagaagatggctgacatcgctggcgagcagaccggctgg
gggaaaatcgccgaaggccaggccctgggtgccacactggcctctggcgggaaagacgcc
gtatccgccctcgaagcagtggagaagaagggcggcaacgatggcataacctgggtcggt
ggagacaaggccggcggctccggccagaagcccattcgcatcgtcaacgacgtgacccgg
gcgggctacaacctgttgaccagccgctcagtgaatgactcgtcgagcgtgccttccgcc
acttgcaacaacggcctggtctgcaacacctggtcctccccccaggaagccgccgcgttc
gccacccgggttctgggcgaacaacagcaacagacctgtgaaggctgtcagaagacggtg
acggcggcaggcgtcggcctgaccccgctgatccaagagacctacgacaagaagctccag
tcgctgcaggagctgctgtcgaaaagtaagccactgaccgccgagaacctggctgcggcc
ggcaccgatgccttgccgatcacccgcggcgtcatcgaggcgctgcgcgacgagcgtgac
caggacgtcctggcgcgccgcctggcgtccgatgtctccctgatggacgtgctcagcaag
gccctgttgttgcagcgcctgatgttcgccggcgccaaggagcccaacgtcgccgccaac
ggcctggccacccaagccgtcgatcagcagaccagcctcctgcagcaggagatctccaat
ctcaagaccgaactggaactccgtcgcgagttggccagcaattcgcccatgcgggtcatc
gagcgcgggcaacagcgcgcctcagggtccagtggcgtgttcgagtcggcgcccgatgcc
gatcgcctcgatcgcctgcaggccccctctgccgccgacggcaagacgggagggagaccg
tga

DBGET integrated database retrieval system